The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC32",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/nm",
"project": {
"title": "Structural model of the cytosolic domain of the plant ethylene receptor 1 (ETR1).",
"publication": {
"title": "Structural model of the cytosolic domain of the plant ethylene receptor 1 (ETR1).",
"author_list": "Mayerhofer H, Panneerselvam S, Kaljunen H, Tuukkanen A, Mertens HD, Mueller-Dieckmann J",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.M114.587667",
"pmid": "25451923",
"published_date": "2015 Jan 30"
},
"status": "released",
"submitted_date": "2017-02-07",
"released_date": "2017-02-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC32.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC32.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC32_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC32_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC32_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC32_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC32.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Custom-built",
"name": "Pilatus 1M-W",
"resolution": 0.172
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": "0.60",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Ethylene Receptor 1",
"short_name": "ETR1(-ΔTM)",
"sequence": "DRHTILKTTLVELGRTLALEECA\r\nLWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG\r\nKYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA\r\nDQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMH\r\nAIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLH\r\nTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI\r\nSVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRS\r\nSGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPA\r\nIPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDV\r\nCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDN\r\nIRDVLSDLLEPRVLYEGM",
"organism": "Arabidopsis thaliana",
"uniprot_code": "P49333",
"uniprot_range_first": 158,
"uniprot_range_last": 738,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGA\nFIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL\nFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA\nLWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG\nKYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA\nDQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMH\nAIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLH\nTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI\nSVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRS\nSGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPA\nIPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDV\nCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDN\nIRDVLSDLLEPRVLYEGM",
"mw": 64.555,
"total_mw": 129.11,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris-NDSB 150 mM NaCl 1mM DTT 250 mM NDSB",
"concentration_unit": "mM",
"comment": null,
"additive": "150 mM NaCl, 1mM DTT, 250 mM NDSB",
"concentration": 20.0,
"pka": null,
"ph": 8.8,
"deuteration": null
},
"purity_method": null,
"name": "Ethylene Receptor 1 Cytosolic Domain (in 250 mM NDSB)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": 78367,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
},
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Anne",
"contributor_surname": "Tuukkanen",
"orcid": null
}
],
"concentration_method": "A280",
"concentration_unit": "mg/ml",
"date": "2011-03-19",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 15.0,
"number_of_frames": 8,
"wavelength": 0.15,
"sample_detector_distance": 3.1,
"concentration_min": 0.7,
"concentration_max": 2.7,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.141,
"s_max": 6.024,
"total_exposure_time": 120.0,
"seccolumn": null
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.582564,
"p_value": 0.0066,
"fit_residual_plot": "fit4columns764_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1.log",
"software_version": "2.0",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC32_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC32_fit1_model1.pdb",
"model_mw": 129.5,
"bead_radius": 1.9,
"log": null,
"symmetry": "P2",
"comment": "",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit2_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 2.1316,
"p_value": 0.0,
"fit_residual_plot": "SASDC32_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit3_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.07,
"p_value": 0.0,
"fit_residual_plot": "SASDC32_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit3.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit4_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.34,
"p_value": 0.0007,
"fit_residual_plot": "SASDC32_fit4_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit4.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC32_fit4_model1_img.png",
"software": "MONSA",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "1.44",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC32_fit4_model1.pdb",
"model_mw": null,
"bead_radius": 4.5,
"log": null,
"symmetry": "",
"comment": "Global refinement of GAF-DHp-CA-RD + DHp-CA-RD + DHp-CA data (3 sets)",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit5_fixed_fit_img.png",
"software": "MONSA",
"chi_square_value": 1.11,
"p_value": 0.0,
"fit_residual_plot": "SASDC32_fit5_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit5.fit",
"fit_log": null,
"software_version": "1.44",
"description": ""
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit6_fixed_fit_img.png",
"software": "MONSA",
"chi_square_value": 0.734,
"p_value": 0.0,
"fit_residual_plot": "SASDC32_fit6_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit6.fit",
"fit_log": null,
"software_version": "1.44",
"description": ""
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC32_fit7_fixed_fit_img.png",
"software": "MONSA",
"chi_square_value": 0.907,
"p_value": 0.0004,
"fit_residual_plot": "SASDC32_fit7_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC32_fit7.fit",
"fit_log": null,
"software_version": "1.44",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM",
"i0_calibration_standard": "BSA",
"description": "Cytosolic domain of ETR1 in 250 mM NBSB",
"experiment_description": null,
"tags": [
"X33"
],
"intensity_unit": null,
"experimental_mw": 54.09,
"experimental_mw_error": 5.0,
"guinier_i0_mw": 54.09,
"guinier_i0_mw_error": 5.0,
"porod_mw": 186.0,
"porod_mw_error": 20.0,
"pddf_i0": 72.3,
"pddf_i0_error": 0.3,
"guinier_i0": 67.8,
"guinier_i0_error": 0.7,
"pddf_rg": 5.2,
"pddf_rg_error": 0.1,
"guinier_rg": 4.7,
"guinier_rg_error": 0.2,
"pddf_dmax": 15.8,
"pddf_dmax_error": 0.5,
"porod_volume": 316.0,
"porod_volume_error": 50.0,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 47,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC32_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:21:52.654103+02:00",
"bragg_peak": []
}
