The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC48",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Disulfide isomerase activity of the dynamic, trimeric <b><i>Proteus mirabilis</i></b> ScsC protein is primed by the tandem immunoglobulin-fold domain of ScsB.",
"publication": {
"title": "Disulfide isomerase activity of the dynamic, trimeric <b><i>Proteus mirabilis</i></b> ScsC protein is primed by the tandem immunoglobulin-fold domain of ScsB.",
"author_list": "Furlong EJ, Choudhury HG, Kurth F, Duff AP, Whitten AE, Martin JL",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.RA118.001860",
"pmid": "29491145",
"published_date": "2018 Apr 20"
},
"status": "released",
"submitted_date": "2017-10-05",
"released_date": "2018-02-21"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC48.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC48.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC48_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC48_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC48_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC48_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC48.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DsbA-like protein",
"short_name": "ScsC",
"sequence": "SNAALNAAQEKEVRALVRDTLVSNPEILEEAIMALQTKKADEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLEKITEQYPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLDNASIEDAMKSTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILPGAVDYDQLEIIVKEQLAKVKK",
"organism": "Proteus mirabilis",
"uniprot_code": "C2LPE2",
"uniprot_range_first": 22,
"uniprot_range_last": 243,
"oligomerization": "trimer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 24.768,
"total_mw": 74.304,
"number_molecules": 3,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Putative metal resistance protein",
"short_name": "ScsB",
"sequence": "MHHHHHHSSGVDLGTENLYFQSNADTGWLTMPDNDHAQVRATADKSSTGDVKILLEVQLAPGWKTYWRSPGEGGVAPEINWTQSVSDMIWHWPSPSAFDVAGIHTQGYDKEVVFPIELKSVDSDNLNGVLTLSTCSNVCILTDYSLNLDLNEPAPADFEWQYNQAMAKVPVTSGLISAVSSDYRNSQLTLSLQREQGDWHQPNIYLDPPQGMLYGIPQLTAKGDHLSVTVDVTDDWGDAAGDITGKALSFVVTDDGYSRQVNDTIGQGDSASLPTADS",
"organism": "Proteus mirabilis",
"uniprot_code": "B4EV20",
"uniprot_range_first": 22,
"uniprot_range_last": 275,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MVRSFLIALMLMLFSLSSLAADTGWLTMPDNDHAQVRATADKSSTGDVKILLEVQLAPGW\nKTYWRSPGEGGVAPEINWTQSVSDMIWHWPSPSAFDVAGIHTQGYDKEVVFPIELKSVDS\nDNLNGVLTLSTCSNVCILTDYSLNLDLNEPAPADFEWQYNQAMAKVPVTSGLISAVSSDY\nRNSQLTLSLQREQGDWHQPNIYLDPPQGMLYGIPQLTAKGDHLSVTVDVTDDWGDAAGDI\nTGKALSFVVTDDGYSRQVNDTIGQGDSASLPTADSGVGLWSILAFALLGGLILNLMPCVL\nPVLAMKLGSILHIEKRDTGAIRKQFSVSVVGILVSFWALALFMTVLRYSQEAIGWGIQFQ\nSPWFIGFMVLITAIFTANLFGLFELRLSSNMNTKIATAGGQGYSRHFWEGAFATLLATPC\nSAPFLGTAVAYALIAPLSELWLIFTALGLGMSLPWIMVAMFPSIAKVLPKPGKWMNRLRV\nVLGFMMLLSCIWLITLLIPHFGIGIVAAIFVAIALILLFAIAKHYGKKTLFASMVITLIL\nGGTSYLFIAQPDTQTLAGQDHVNWQPLSEEAIHQALAENKRVFIDVTADWCVTCKANKYN\nVLLRDDVQKALSEPDVVALRGDWTKPSEQITQFLKQRGQVAVPFNQIYGPCNKEGEILPP\nLLNKDLMLTILSEAKGAQ",
"mw": 30.343,
"total_mw": 30.343,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10mM HEPES, 150mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "ScsC-ScsBalpha complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Andrew",
"contributor_surname": "Whitten",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-11-02",
"storage_temperature": 4.0,
"cell_temperature": 10.0,
"exposure_time": 1.0,
"number_of_frames": 13,
"wavelength": 0.1033,
"sample_detector_distance": 2.68,
"concentration_min": 0.56,
"concentration_max": 4.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.105,
"s_max": 2.999,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC48_fit1_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "7.d",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC48_fit1_model1.pdb",
"model_mw": 99.99,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/run1_ZoMbNC2.log",
"symmetry": "P1",
"comment": "Overall symmetry is P1, but the ScsC component possesses P3 symmetry",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC48_fit1_fit_img.png",
"software": "SASREF",
"chi_square_value": 1.7956,
"p_value": 0.0,
"fit_residual_plot": "SASDC48_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC48_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run1_ZTJcGes.log",
"software_version": "7.d",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from solutions of Suppressor of Copper Sensitivity C protein (ScsC) complexed with the alpha domain of the Suppressor of Copper Sensitivity B protein from Proteus mirabilis in 10 mM HEPES 100mM NaCl, pH 7.5 were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) using a 2D Photon counting Pilatus 1M-W pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). Thirteen successive 1 second frames were collected across solute concentrations of 0.56-4.50 mg/ml. The SAXS data displayed this entry was derived from a 0.56 mg/ml sample. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. Small-angle neutron scattering data with contrast variation were also collected on the QUOKKA instrument at the Australian Nuclear Science and Technology Organisation at a solute concentration of ~5.0 mg/ml. A rigid-body model was co-refined against the SAXS and SANS data using using SASREF (v 7.d), and this model is shown, together with the X-ray data and correspond fit. Details of the SANS data collection, corresponding fits, and additional analysis are contained in a downloadable zip archive.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 95.0,
"experimental_mw_error": null,
"guinier_i0_mw": 95.0,
"guinier_i0_mw_error": 5.0,
"porod_mw": 119.0,
"porod_mw_error": null,
"pddf_i0": 0.04026,
"pddf_i0_error": 0.0001,
"guinier_i0": 0.04057,
"guinier_i0_error": 0.00012,
"pddf_rg": 3.87,
"pddf_rg_error": 0.01,
"guinier_rg": 3.92,
"guinier_rg_error": 0.02,
"pddf_dmax": 11.5,
"pddf_dmax_error": 3.0,
"porod_volume": 145.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 30,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC48_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-06-15T11:36:42.269791+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC48",
"status": "success",
"started_at": "2026-08-11T15:45:23.446957+00:00",
"finished_at": "2026-08-11T15:45:32.777217+00:00",
"source_last_modified": "2020-06-15T11:36:42.269791+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC48/",
"path": "/data/saxsdb/sasbdb/entries/48/sasdc48/source/summary.json",
"size": 9636,
"sha256": "292803372ae36f00be23c5dcfbd4cf8f9f1be1748fa081ad35dd71dfa34ecbe3"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC48.dat",
"path": "/data/saxsdb/sasbdb/entries/48/sasdc48/source/SASDC48.dat",
"size": 19412,
"sha256": "e576f575a87943c6109645f6c63ff5984fbd5fdeca35fe0766ecd321c83a51b1",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC48.out",
"path": "/data/saxsdb/sasbdb/entries/48/sasdc48/source/SASDC48.out",
"size": 32163,
"sha256": "4a8547854c04a364de741ab87b24e5887d70a97915e121ce62bb3d4ac5e21889",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC48.sascif",
"path": "/data/saxsdb/sasbdb/entries/48/sasdc48/source/SASDC48.sascif",
"size": 734618,
"sha256": "945bf974e9917a4e027a1dbbb42e528a81ac4dcd51f0b64657571b5b2d446a78",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC48.zip",
"path": "/data/saxsdb/sasbdb/entries/48/sasdc48/source/SASDC48.zip",
"size": 398972,
"sha256": "5c6ad30578b24129f0fdf84662bf714af74a7bc05447b08967709a71037d3378",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
