Plasmodium falciparum p23A

{
  "code": "SASDC55",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Comparative studies of the low-resolution structure of two p23 co-chaperones for Hsp90 identified in Plasmodium falciparum genome.",
    "publication": {
      "title": "Comparative studies of the low-resolution structure of two p23 co-chaperones for Hsp90 identified in Plasmodium falciparum genome.",
      "author_list": "Silva NSM, Seraphim TV, Minari K, Barbosa LRS, Borges JC",
      "journal": "Int J Biol Macromol",
      "doi": "10.1016/j.ijbiomac.2017.11.161",
      "pmid": "29191421",
      "published_date": "2018 Mar"
    },
    "status": "released",
    "submitted_date": "2017-06-17",
    "released_date": "2017-12-05"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC55.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC55.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC55_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC55_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC55_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC55_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC55.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "MAR 165 CCD",
        "resolution": null
      },
      "name": "Brazilian Synchrotron Light Laboratory",
      "city": "Campinas",
      "country": "Brazil",
      "beamline_name": "SAXS2 Beamline",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "CS domain protein, putative",
          "short_name": "Pfp23A",
          "sequence": "GSHMGEIYNKRHKYMNNGVLIYEWEQSIDEINIYIDMNSKLVNKNDLNIEIKSKRITIGLKNTKNFLEGE\r\nLFSIIDEDCSYWFIEDNNLHILLTKVKKGESWNSVFKGHKNLNPVDEDNTKKQILLERFQQEYPNFDFSS\r\nASFNGQVPDARTFMGGLKY",
          "organism": "Plasmodium falciparum",
          "uniprot_code": "Q8I2N9",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGEIYNKRHKYMNNGVLIYEWEQSIDEINIYIDMNSKLVNKNDLNIEIKSKRITIGLKNT\nKNFLEGELFSIIDEDCSYWFIEDNNLHILLTKVKKGESWNSVFKGHKNLNPVDEDNTKKQ\nILLERFQQEYPNFDFSSASFNGQVPDARTFMGGLKY",
          "mw": 18.65,
          "total_mw": 18.65,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, 1 mM B-mercaptoethanol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Plasmodium falciparum p23A",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "São Carlos - SP - Brasil",
            "full_name": "Instituto de Química de São Carlos",
            "webpage": ""
          }
        ],
        "contributor_name": "Júlio",
        "contributor_surname": "Borges",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-05-26",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 180.0,
    "number_of_frames": 1,
    "wavelength": 0.1488,
    "sample_detector_distance": 1.0,
    "concentration_min": 2.5,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.184,
    "s_max": 3.181,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC55_fit1_model1_img.png",
          "software": "DAMFILT",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "5.0",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDC55_fit1_model1.pdb",
          "model_mw": 22.642,
          "bead_radius": 2.0,
          "log": null,
          "symmetry": "P1",
          "comment": "Average of 10 models generated by DAMMIN",
          "user": 161
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC55_fit1_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 0.684,
      "p_value": 0.0,
      "fit_residual_plot": "SASDC55_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC55_fit1.fir",
      "fit_log": null,
      "software_version": "5.3",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.6",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS measurements were performed at the SAXS2 beam line located at the Brazilian Synchrotron Light Laboratory (LNLS), Campinas, São Paulo, Brazil. The X-ray scattering data (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle; λ = 0.1488 nm) were acquired using a two-dimension position-sensitive MARR-CCD detector and a sample-to-detector distance of ~1000 mm, corresponding to the q-range 0 < q < 0.35. In order to checking for protein aggregation or concentration-dependent effects, samples were prepared at various protein concentrations (2.5 mg/mL, 3 mg/mL and 5 mg/mL) in the buffer 25 mM Tris-HCl (pH 7.5), containing 150 mM NaCl, 2 mM EDTA and 1 mM β-mercaptoethanol. Samples were exposed to X-ray at different time frames (5 x 30 seconds, and 180 seconds) to investigate for X-ray damage. No radiation damage or concentration-dependent effect were observed. The model depicts the averaged spatial representation of the protein (DAMFILT occupancy and volume-corrected bead model).",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 21.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.01292,
  "pddf_i0_error": 0.000139,
  "guinier_i0": 0.012933,
  "guinier_i0_error": 7.5e-05,
  "pddf_rg": 2.55,
  "pddf_rg_error": 0.03,
  "guinier_rg": 2.47,
  "guinier_rg_error": 0.09,
  "pddf_dmax": 8.5,
  "pddf_dmax_error": 5.0,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 29,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDC55_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDC55",
  "status": "success",
  "started_at": "2026-08-11T14:38:37.863417+00:00",
  "finished_at": "2026-08-11T14:38:45.723264+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC55/",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdc55/source/summary.json",
      "size": 7672,
      "sha256": "3d1219612ee1b397e4845103ac6d2685f238b8b515df6eee6d0825af1782c1a2"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDC55.dat",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdc55/source/SASDC55.dat",
      "size": 10826,
      "sha256": "034afcb0f62ba78e797c94a438c87bb31ea01fdb00a2dd165966fc62143d7a76",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDC55.out",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdc55/source/SASDC55.out",
      "size": 24469,
      "sha256": "23adf6efe1292e94554bade66eb25ba6bc48cc235441123890921558e3f945fb",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC55.sascif",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdc55/source/SASDC55.sascif",
      "size": 148364,
      "sha256": "f0b14d28c4c69796a3cdcaefc1133f736bc8c94c82f4526e1abed4fd4695dfd1",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDC55.zip",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdc55/source/SASDC55.zip",
      "size": 24932,
      "sha256": "e5092a63f722a62fc853adf6dab0fad6417d50758e63670fcacb22b247c7260b",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}