Basic domain of telomeric repeat-binding factor 2 (TRF2)

{
  "code": "SASDC62",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Basic domain of telomere guardian TRF2 reduces D-loop unwinding whereas Rap1 restores it.",
    "publication": {
      "title": "Basic domain of telomere guardian TRF2 reduces D-loop unwinding whereas Rap1 restores it.",
      "author_list": "Necasová I, Janoušková E, Klumpler T, Hofr C",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkx812",
      "pmid": "28981702",
      "published_date": "2017 Dec 1"
    },
    "status": "released",
    "submitted_date": "2017-01-06",
    "released_date": "2017-09-18"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC62.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC62.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC62_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC62_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC62_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC62_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC62.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "CEITEC",
      "city": "Brno",
      "country": "Czech Republic",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": "",
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Basic domain of telomeric repeat-binding factor 2",
          "short_name": "TRF2",
          "sequence": "GPPGSMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAG",
          "organism": "Homo sapiens",
          "uniprot_code": "Q15554",
          "uniprot_range_first": 42,
          "uniprot_range_last": 86,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRR\nASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQ\nIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEM\nIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNI\nIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK\nQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQ\nALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLN\nSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDE\nDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLG\nMN",
          "mw": 4.587,
          "total_mw": 4.587,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM NaPi, 50 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Basic domain of telomeric repeat-binding factor 2 (TRF2)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
            "webpage": "https://www.ceitec.eu/"
          }
        ],
        "contributor_name": "Tomas",
        "contributor_surname": "Klumpler",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-03-05",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 3600.0,
    "number_of_frames": 6,
    "wavelength": 1.54,
    "sample_detector_distance": 0.48,
    "concentration_min": null,
    "concentration_max": 1.2,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.109,
    "s_max": 6.503,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "primus/qt r8972",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of the basic domain of telomeric repeat-binding factor 2 (TRF2) in 50 mM sodium phosphate, 50 mM NaCl, pH 7, were collected using a Rigaku BioSAXS-1000 instrument at CEITEC (Brno, Czech Republic) equipped with a Pilatus 100K detector at a sample-detector distance of 0.5 m (I(s) vs s, where = 4π sin θ/λ; 2θ is the scattering angle and λ = 0.154 nm). Six successive 3600 second frames were collected at a sample temperature of 4°C using a solute concentration of 1.2 mg/ml. The data were normalized to the intensity of the transmitted beam and radially averaged and the corresponding scattering from the solvent-blank was subtracted to produced the scattering profile displayed in this entry.",
  "tags": [
    "idp"
  ],
  "intensity_unit": null,
  "experimental_mw": 4.587,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 2.3,
  "porod_mw_error": null,
  "pddf_i0": 0.106,
  "pddf_i0_error": 0.001,
  "guinier_i0": 0.103287,
  "guinier_i0_error": 0.000861426,
  "pddf_rg": 1.819,
  "pddf_rg_error": 0.03,
  "guinier_rg": 1.657,
  "guinier_rg_error": 0.168,
  "pddf_dmax": 7.06,
  "pddf_dmax_error": null,
  "porod_volume": 3.69,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 6,
  "guinier_point_last": 48,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDC62_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2022-03-31T22:26:26.370859+02:00",
  "bragg_peak": []
}

{
  "code": "SASDC62",
  "status": "success",
  "started_at": "2026-08-11T13:31:12.464729+00:00",
  "finished_at": "2026-08-11T13:31:19.977441+00:00",
  "source_last_modified": "2022-03-31T22:26:26.370859+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC62/",
      "path": "/data/saxsdb/sasbdb/entries/62/sasdc62/source/summary.json",
      "size": 6565,
      "sha256": "8d8ca2dc7efa81c5812d57ada1271c367840c749b465514ca8168652802c93d5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDC62.dat",
      "path": "/data/saxsdb/sasbdb/entries/62/sasdc62/source/SASDC62.dat",
      "size": 13961,
      "sha256": "66ed1bfa9a0fd3efa441ee577bce1a635ce2e55623f443b08e5e4e0822600b8e",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDC62.out",
      "path": "/data/saxsdb/sasbdb/entries/62/sasdc62/source/SASDC62.out",
      "size": 35793,
      "sha256": "a0afd3b56c59fd56e92298d82d187d8d029a645404e9340ef6dbd954a3042e36",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC62.sascif",
      "path": "/data/saxsdb/sasbdb/entries/62/sasdc62/source/SASDC62.sascif",
      "size": 51466,
      "sha256": "d22db3e75fe136f5d5b0951d851a3e84b08e4277ffb2a8b698d90197f4775a05",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDC62.zip",
      "path": "/data/saxsdb/sasbdb/entries/62/sasdc62/source/SASDC62.zip",
      "size": 14853,
      "sha256": "1233cda5b66a0b1ae82a0d3141d78f51665a876d6918943db00b138cd1b7c326",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}