The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC66",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/nm",
"project": {
"title": "The switch that does not flip: the blue-light receptor YtvA from Bacillus subtilis adopts an elongated dimer conformation independent of the activation state as revealed by a combined AUC and SAXS study.",
"publication": {
"title": "The switch that does not flip: the blue-light receptor YtvA from Bacillus subtilis adopts an elongated dimer conformation independent of the activation state as revealed by a combined AUC and SAXS study.",
"author_list": "Jurk M, Dorn M, Kikhney A, Svergun D, Gärtner W, Schmieder P",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2010.08.036",
"pmid": "20800068",
"published_date": "2010 Oct 15"
},
"status": "released",
"submitted_date": "2017-07-03",
"released_date": "2017-07-14"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC66.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC66.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC66_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC66_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC66_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC66_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC66.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Custom-built",
"name": "Pilatus 1M-W",
"resolution": 0.172
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": "0.60",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "pfyP - Blue light photoreceptor",
"short_name": "YtvA",
"sequence": "GASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK\r\nNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV\r\nGIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTN\r\nILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDA\r\nNFSSLKTYSNVKDAVKVLPIM",
"organism": "Bacillus subtilis",
"uniprot_code": "O34627",
"uniprot_range_first": 2,
"uniprot_range_last": 261,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK\nNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV\nGIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTN\nILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDA\nNFSSLKTYSNVKDAVKVLPIM",
"mw": 29.12,
"total_mw": 58.24,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "PBS + 5 mM DTT",
"concentration_unit": null,
"comment": "10 mM phosphate buffer; 2.7 mM KCl; 137 mM NaCl; 5 mM DTT",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Blue light receptor YtvA, lit/active state",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": false
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Berlin, Germany",
"full_name": "Leibniz-Institut für Molekulare Pharmakologie",
"webpage": "http://www.leibniz-fmp.de"
}
],
"contributor_name": "Marcel",
"contributor_surname": "Jurk",
"orcid": null
},
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Al",
"contributor_surname": "Kikhney",
"orcid": "https://orcid.org/0000-0003-1321-3956"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2009-10-24",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 30.0,
"number_of_frames": 4,
"wavelength": 0.15,
"sample_detector_distance": 2.7,
"concentration_min": 1.7,
"concentration_max": 11.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.077,
"s_max": 6.237,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC66_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC66_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": "P2",
"comment": "",
"user": 225
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC66_fit1_fit_img.png",
"software": "GASBOR",
"chi_square_value": 9.07,
"p_value": 0.0,
"fit_residual_plot": "SASDC66_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC66_fit1.fir",
"fit_log": null,
"software_version": "",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC66_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC66_fit2_model1.pdb",
"model_mw": 47.1,
"bead_radius": 2.2,
"log": null,
"symmetry": "P2",
"comment": "",
"user": 225
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC66_fit2_model2_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC66_fit2_model2.pdb",
"model_mw": 46.83,
"bead_radius": 3.25,
"log": null,
"symmetry": "",
"comment": "",
"user": 225
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC66_fit2_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 7.896,
"p_value": 0.0,
"fit_residual_plot": "SASDC66_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC66_fit2.fir",
"fit_log": null,
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [
"X33"
],
"intensity_unit": null,
"experimental_mw": 46.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 46.0,
"porod_mw_error": null,
"pddf_i0": 68.65,
"pddf_i0_error": null,
"guinier_i0": 69.76,
"guinier_i0_error": null,
"pddf_rg": 3.178,
"pddf_rg_error": null,
"guinier_rg": 3.18,
"guinier_rg_error": 0.1,
"pddf_dmax": 10.1,
"pddf_dmax_error": 1.0,
"porod_volume": 74.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 28,
"guinier_point_last": 113,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC66_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:21:52.654103+02:00",
"bragg_peak": []
}
