The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.dat",
"role": "curve",
"sha256": "cf1e45f7bfde04f04e71ec01f415679454b4e0d6af15210b9076c4b5bedf6f11",
"size": 57480,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC82.dat"
} full_entry_zip：source record and ZIP contents (4 items) {
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.zip",
"role": "full_entry_zip",
"sha256": "a124e8cde13b7165623634851f57ee5af14bbf57bd602819e83040fee12da61f",
"size": 31935,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC82.zip",
"zip_member_count": 4,
"zip_members": [
{
"crc32": "223974a5",
"name": "SASDC82/experimental_data/SASDC82.dat",
"size": 57480
},
{
"crc32": "7fcc69eb",
"name": "SASDC82/pddf/SASDC82.out",
"size": 31544
},
{
"crc32": "d8f86c72",
"name": "SASDC82/SASDC82_fit1.fir",
"size": 18977
},
{
"crc32": "4f9fe3c2",
"name": "SASDC82/SASDC82_fit1_model1.pdb",
"size": 47139
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.out",
"role": "pddf",
"sha256": "9669776a75d51d44d654dabed59050a57a5e63471eb9e313a8bf3baecda9ad9b",
"size": 31544,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC82.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.sascif",
"role": "sascif",
"sha256": "b3bc484295454ba6744de64492e92dc981bd6289b777abc0253aa13128cd8c62",
"size": 163108,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC82.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/summary.json",
"sha256": "3e07fc4a6410a8b2c69a3baaeed83ff4153f6166b49017fe57331fa0dc14caa5",
"size": 9622,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC82/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：156 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDC82",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/nm",
"project": {
"title": "A homologue of the Parkinson's disease-associated protein LRRK2 undergoes a monomer-dimer transition during GTP turnover.",
"publication": {
"title": "A homologue of the Parkinson's disease-associated protein LRRK2 undergoes a monomer-dimer transition during GTP turnover.",
"author_list": "Deyaert E, Wauters L, Guaitoli G, Konijnenberg A, Leemans M, Terheyden S, Petrovic A, Gallardo R, Nederveen-Schippers LM, Athanasopoulos PS, Pots H, Van Haastert PJM, Sobott F, Gloeckner CJ, Efremov R, Kortholt A, Versées W",
"journal": "Nat Commun",
"doi": "10.1038/s41467-017-01103-4",
"pmid": "29044096",
"published_date": "2017 Oct 18"
},
"status": "released",
"submitted_date": "2017-03-21",
"released_date": "2017-10-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC82.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC82.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC82_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC82_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC82_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC82_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC82.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Rab family protein",
"short_name": "CtRoco",
"sequence": "MSYYHHHHHHDYDIPTTENLYFQGAMGSMSDLDVIRQIEQELGMQLEPVDKLKWYSKGYKLDKDQRVTAIGLYDCGSDTLDRIIQPLESLKSLSELSLSSNQITDISPLASLNSLSMLWLDRNQITDIAPLASLNSLSMLWLFGNKISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSLSSNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLESLNSLSKLWLNGNQITDIAPLASLNSLTELELSSNQITDIAPLASLKSLSTLWLSSNQISDIAPLASLESLSELSLSSNQISDISPLASLNSLTGFDVRRNPIKRLPETITGFDMEILWNDFSSSGFITFFDNPLESPPPEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGETFDPKESQTHGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCKNGDGVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRCDEYDPAKNNKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVISKEERNKERLMGDINIKLENIGNPTIPIHQQVEVNVSQETVQHVENLQGFFENLKADILREAELEIDDPKERKRLANELELAENAITKMDAAVKSGKNKLKPDVKDRLGEFIDNLANENSRLRKGIALVMNGAEKVQKLARYYNNVAPFFDLPSVPPVLLGKEKT",
"organism": "Chlorobaculum tepidum",
"uniprot_code": "Q8KC98",
"uniprot_range_first": 1,
"uniprot_range_last": 1102,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSDLDVIRQIEQELGMQLEPVDKLKWYSKGYKLDKDQRVTAIGLYDCGSDTLDRIIQPLE\nSLKSLSELSLSSNQITDISPLASLNSLSMLWLDRNQITDIAPLASLNSLSMLWLFGNKIS\nDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSL\nSSNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLESLKS\nLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLESLNSLSKLWLNGNQITDIAP\nLASLNSLTELELSSNQITDIAPLASLKSLSTLWLSSNQISDIAPLASLESLSELSLSSNQ\nISDISPLASLNSLTGFDVRRNPIKRLPETITGFDMEILWNDFSSSGFITFFDNPLESPPP\nEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGETFDPK\nESQTHGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLL\nDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISC\nKNGDGVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICND\nSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLN\nTSALGYILNEEQIRCDEYDPAKNNKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNL\nPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEG\nALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDE\nLVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVISKEERNKERLMGDINIKLENIGN\nPTIPIHQQVEVNVSQETVQHVENLQGFFENLKADILREAELEIDDPKERKRLANELELAE\nNAITKMDAAVKSGKNKLKPDVKDRLGEFIDNLANENSRLRKGIALVMNGAEKVQKLARYY\nNNVAPFFDLPSVPPVLLGKEKT",
"mw": 127.147,
"total_mw": 254.294,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES 150 mM NaCl 5 mM MgCl2 5% Glycerol 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Rab family protein CtRoco nucleotide free",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "VUB",
"address": "Pleinlaan 2 1050 Brussel ",
"full_name": "Vrije Universiteit Brussel",
"webpage": "http://www.vub.ac.be/"
}
],
"contributor_name": "Egon",
"contributor_surname": "Deyaert",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-02-16",
"storage_temperature": null,
"cell_temperature": 25.0,
"exposure_time": null,
"number_of_frames": 55,
"wavelength": 0.099,
"sample_detector_distance": null,
"concentration_min": 1.0,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.032,
"s_max": 4.975,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC82_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC82_fit1_model1.pdb",
"model_mw": 283.95,
"bead_radius": 5.5,
"log": "https://www.sasbdb.org/media/log_files/refine_kEg200J.log",
"symmetry": "P2",
"comment": "",
"user": 98
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC82_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 9.3,
"p_value": 0.078515,
"fit_residual_plot": "SASDC82_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC82_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/refine_eK7rGlo.log",
"software_version": "5.3",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM 4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Rab family protein CtRoco (nucleotide free) in 20 mM HEPES 150 mM NaCl 5 mM MgCl2 5% Glycerol 1 mM DTT, pH 7.5 were collected on the BM29 camera on the storage ring ESRF (Grenoble, France) using a Pilatus 1M detector at a wavelength of λ = 0.099 nm (I(s) vs s, where s = 4πsin θ/λ and 2θ is the scattering angle). Inline SEC-SAXS was employed at 25°C (50 µl injection volume of an 8 mg/ml protein solution on a Bio SEC-3 HPLC column (Agilent, 3 µm 300 Å)). 55 successive frames were collected through the elution peak. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled and averaged to produce the final SAXS data displayed in this entry.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 246.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 259.0,
"porod_mw_error": null,
"pddf_i0": 125.4,
"pddf_i0_error": 0.06,
"guinier_i0": 125.13,
"guinier_i0_error": 0.0625,
"pddf_rg": 5.04,
"pddf_rg_error": 0.004,
"guinier_rg": 4.98,
"guinier_rg_error": 0.004,
"pddf_dmax": 18.39,
"pddf_dmax_error": null,
"porod_volume": 440.41,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 7,
"guinier_point_last": 49,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC82_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDC82",
"status": "success",
"started_at": "2026-08-11T13:32:29.371590+00:00",
"finished_at": "2026-08-11T13:32:39.637281+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC82/",
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/summary.json",
"size": 9622,
"sha256": "3e07fc4a6410a8b2c69a3baaeed83ff4153f6166b49017fe57331fa0dc14caa5"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC82.dat",
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.dat",
"size": 57480,
"sha256": "cf1e45f7bfde04f04e71ec01f415679454b4e0d6af15210b9076c4b5bedf6f11",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC82.out",
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.out",
"size": 31544,
"sha256": "9669776a75d51d44d654dabed59050a57a5e63471eb9e313a8bf3baecda9ad9b",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC82.sascif",
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.sascif",
"size": 163108,
"sha256": "b3bc484295454ba6744de64492e92dc981bd6289b777abc0253aa13128cd8c62",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC82.zip",
"path": "/data/saxsdb/sasbdb/entries/82/sasdc82/source/SASDC82.zip",
"size": 31935,
"sha256": "a124e8cde13b7165623634851f57ee5af14bbf57bd602819e83040fee12da61f",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
} 
