The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC84",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/A",
"project": {
"title": "A unique hetero-hexadecameric architecture displayed by the Escherichia coli O157 PaaA2-ParE2 antitoxin-toxin complex.",
"publication": {
"title": "A unique hetero-hexadecameric architecture displayed by the Escherichia coli O157 PaaA2-ParE2 antitoxin-toxin complex.",
"author_list": "Sterckx YG, Jové T, Shkumatov AV, Garcia-Pino A, Geerts L, De Kerpel M, Lah J, De Greve H, Van Melderen L, Loris R",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2016.03.007",
"pmid": "26996937",
"published_date": "2016 Apr 24"
},
"status": "released",
"submitted_date": "2015-08-24",
"released_date": "2016-03-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC84.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC84.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC84_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC84_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC84_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC84_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC84.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Plasmid stabilization protein ParE",
"short_name": "ParE2",
"sequence": "MGSSHHHHHHSSGLVPRGSHLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVEVVNVIHARRQF",
"organism": "Escherichia coli",
"uniprot_code": "A0A0D7C2L1",
"uniprot_range_first": 2,
"uniprot_range_last": 92,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLR\nEIVAHPNYIILYRVTTSSVEVVNVIHARRQFP",
"mw": 12.596,
"total_mw": 12.596,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Uncharacterized protein",
"short_name": "PaaA2",
"sequence": "METIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ",
"organism": "Escherichia coli O157:H7",
"uniprot_code": "A0A0F6F6Q9",
"uniprot_range_first": 13,
"uniprot_range_last": 63,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 6.231,
"total_mw": 6.231,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris-HCl, 500 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "parDE-like toxin-antitoxin module, EcPaaA2_13-63-HisEcParE2 construct",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "VUB",
"address": "Pleinlaan 2 1050 Brussel ",
"full_name": "Vrije Universiteit Brussel",
"webpage": "http://www.vub.ac.be/"
}
],
"contributor_name": "Alexander",
"contributor_surname": "Shkumatov",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2012-02-05",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.75,
"number_of_frames": 250,
"wavelength": 0.103,
"sample_detector_distance": 1.82,
"concentration_min": null,
"concentration_max": 12.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.238,
"s_max": 4.003,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC84_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "r4556/NA",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC84_fit1_model1.pdb",
"model_mw": 18.89,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 104
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC84_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "r4556/NA",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC84_fit1_model2.pdb",
"model_mw": 18.89,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 104
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC84_fit1_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "r8972/NA",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC84_fit1_model3.pdb",
"model_mw": 18.89,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 104
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC84_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 0.76,
"p_value": 0.0,
"fit_residual_plot": "fit4columns905_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC84_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_010_1.log",
"software_version": "v2.1(4556)",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0 (r4547)",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from EcPaaA2_13-63-EcParE2 were collected at the SWING beamline (SOLEIL synchrotron, Gif-sur-Yvette, France) in HPLC mode using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.103 nm (s = 4π sin θ/λ, where 2θ is the scattering angle). Sample was loaded onto a Shodex KW402.5-4F, which was pre-equilibrated with running buffer (50 mM Tris-HCl, 500 mM NaCl, pH 7.5) for at least one column volume. The flow rate was set to 0.2 ml/min. During each HPLC run, 250 frames were collected after 15 min (0.62 CV) using 750 ms per frame and 1500 ms dead time. After radial averaging and buffer subtraction of the data frames using FOXTROT, the scattering curves were processed and analyzed with DATASW.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 21.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 21.0,
"porod_mw_error": null,
"pddf_i0": 0.02,
"pddf_i0_error": 0.01,
"guinier_i0": 0.0213863,
"guinier_i0_error": 0.01,
"pddf_rg": 2.243,
"pddf_rg_error": 0.006,
"guinier_rg": 2.158,
"guinier_rg_error": 0.004,
"pddf_dmax": 9.3,
"pddf_dmax_error": 0.5,
"porod_volume": 35.7,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 52,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC84_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:28:16.357175+02:00",
"bragg_peak": []
}
