Monomeric Sortilin at pH 7.4 in the presence of neurotensin

{
  "code": "SASDCE7",
  "status": "Published",
  "type_of_curve": "Other",
  "angular_unit": "1/nm",
  "project": {
    "title": "Low pH-induced conformational change and dimerization of sortilin triggers endocytosed ligand release.",
    "publication": {
      "title": "Low pH-induced conformational change and dimerization of sortilin triggers endocytosed ligand release.",
      "author_list": "Leloup N, Lössl P, Meijer DH, Brennich M, Heck AJR, Thies-Weesie DME, Janssen BJC",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-017-01485-5",
      "pmid": "29167428",
      "published_date": "2017 Nov 22"
    },
    "status": "released",
    "submitted_date": "2017-07-08",
    "released_date": "2017-12-01"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCE7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCE7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCE7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCE7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCE7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCE7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCE7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Sortilin, also: Neurotensin-receptor 3",
          "short_name": "Sort1, also: NTR3",
          "sequence": "GSGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKVILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSAAAHHHHHH",
          "organism": "Mus musculus",
          "uniprot_code": "Q6PHU5",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRA\nAAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTG\nVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKV\nILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVS\nKNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVK\nIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVF\nMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSED\nNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEP\nNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNR\nPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTV\nDFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQ\nPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDK\nCQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYV\nCGGRFLVHRYSVLQQHAEADGVEALDSTSHAKSGYHDDSDEDLLE",
          "mw": 76.585,
          "total_mw": 153.17,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM HEPES pH 7.4, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Monomeric Sortilin at pH 7.4 in the presence of neurotensin",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "EMBL",
            "address": "Grenoble, France",
            "full_name": "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation",
            "webpage": "https://www.embl.fr/"
          }
        ],
        "contributor_name": "Martha",
        "contributor_surname": "Brennich",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-04-17",
    "storage_temperature": null,
    "cell_temperature": 20.0,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": 0.099,
    "sample_detector_distance": 2.86,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.113,
    "s_max": 2.503,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5",
  "i0_calibration_standard": null,
  "description": "Number of frames used for averaging: unknown.\r\nExposure time: unknown.\r\nSample concentration: unknown.",
  "experiment_description": "Synchrotron SAXS data from solutions of Monomeric Sortilin in the presence of neurotensin in 25 mM HEPES, 150 mM NaCl, pH 7.4, were collected at the BM29 beam line at the ESRF storage ring (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). The data were collected at at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 113.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 113.0,
  "porod_mw_error": null,
  "pddf_i0": 33.8,
  "pddf_i0_error": 0.09,
  "guinier_i0": 33.7,
  "guinier_i0_error": null,
  "pddf_rg": 3.37,
  "pddf_rg_error": 0.02,
  "guinier_rg": 3.34,
  "guinier_rg_error": null,
  "pddf_dmax": 11.7,
  "pddf_dmax_error": null,
  "porod_volume": 192.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 59,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCE7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDCE7",
  "status": "success",
  "started_at": "2026-08-11T15:27:53.271182+00:00",
  "finished_at": "2026-08-11T15:28:01.742556+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCE7/",
      "path": "/data/saxsdb/sasbdb/entries/e7/sasdce7/source/summary.json",
      "size": 7469,
      "sha256": "e4f1aec8e275e294f31c589fea932b2175ed21bdaf03b1b320448707bb7c6e2d"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCE7.dat",
      "path": "/data/saxsdb/sasbdb/entries/e7/sasdce7/source/SASDCE7.dat",
      "size": 23504,
      "sha256": "de943e5e7e5d97bf74b4199464bd8c5037914acff4d5667ec5ab745be25d8d6e",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCE7.out",
      "path": "/data/saxsdb/sasbdb/entries/e7/sasdce7/source/SASDCE7.out",
      "size": 48319,
      "sha256": "1ef0ef6d29b82662b4a5b1b4a71ab212266cef8cd9b00105b393e69df578e7c8",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCE7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/e7/sasdce7/source/SASDCE7.sascif",
      "size": 62788,
      "sha256": "9572836a9aa8df3544910eac20fb2af18c5872c21fa2590a41d77169d59a3139",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCE7.zip",
      "path": "/data/saxsdb/sasbdb/entries/e7/sasdce7/source/SASDCE7.zip",
      "size": 19611,
      "sha256": "e374a691fe6698c233db2832f375bfc29a4e79ece73452a0128459fec60480dc",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}