Nucleolysin TIA-1 isoform p40

{
  "code": "SASDCF3",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/A",
  "project": {
    "title": "Segmental, Domain-Selective Perdeuteration and Small-Angle Neutron Scattering for Structural Analysis of Multi-Domain Proteins.",
    "publication": {
      "title": "Segmental, Domain-Selective Perdeuteration and Small-Angle Neutron Scattering for Structural Analysis of Multi-Domain Proteins.",
      "author_list": "Sonntag M, Jagtap PKA, Simon B, Appavou MS, Geerlof A, Stehle R, Gabel F, Hennig J, Sattler M",
      "journal": "Angew Chem Int Ed Engl",
      "doi": "10.1002/anie.201702904",
      "pmid": "28636238",
      "published_date": "2017 Aug 1"
    },
    "status": "released",
    "submitted_date": "2017-05-04",
    "released_date": "2017-07-24"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCF3.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCF3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCF3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCF3_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCF3_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCF3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCF3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "SFB 1035, Technische Universität München",
      "city": "Garching",
      "country": "Germany",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": "point",
      "type_of_source": "X-ray in house",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": 8.0405,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nucleolysin TIA-1 isoform p40",
          "short_name": "TIA-1 wild type",
          "sequence": "MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCF\r\nVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSNHFHVFV\r\nGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDA\r\nENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS\r\nPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHE\r\nSAAHAIVSVNGTTIEGHVVKCYWGK",
          "organism": "Homo sapiens",
          "uniprot_code": "P31483",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA\nAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE\nDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN\nWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQI\nMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI\nGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGV\nQPPQGQNGSMLPNQPSGYRVAGYETQ",
          "mw": 30.457,
          "total_mw": 30.457,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "10 mM Potassium Phosphate 50 mM NaCl 10 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Nucleolysin TIA-1 isoform p40",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Munich, Germany",
            "full_name": "Technical University Munich",
            "webpage": "https://www.tum.de"
          }
        ],
        "contributor_name": "Miriam",
        "contributor_surname": "Sonntag",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-04-28",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 900.0,
    "number_of_frames": 8,
    "wavelength": 0.1542,
    "sample_detector_distance": 0.482,
    "concentration_min": 2.5,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.209,
    "s_max": 7.056,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of Nucleolysin TIA-1 isoform p40 in 10 mM potassium phosphate, 50 mM NaCl, 10 mM DTT, pH 6 were were collected using a Rigaku BioSAXS-1000 instrument (Munich, Germany) equipped with a Pilatus 100K detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.1542 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 2.5 and 5 mg/ml were measured at 20°C. Eight successive 7200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 29.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": 29.9,
  "guinier_i0_mw_error": null,
  "porod_mw": 29.8,
  "porod_mw_error": null,
  "pddf_i0": 0.0237,
  "pddf_i0_error": 0.0002,
  "guinier_i0": 0.023,
  "guinier_i0_error": 0.0002,
  "pddf_rg": 2.92,
  "pddf_rg_error": 0.04,
  "guinier_rg": 2.73,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 11.2,
  "pddf_dmax_error": null,
  "porod_volume": 38.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 5,
  "guinier_point_last": 22,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCF3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-12-14T13:41:02.534142+01:00",
  "bragg_peak": []
}

{
  "code": "SASDCF3",
  "status": "success",
  "started_at": "2026-08-11T13:58:54.311278+00:00",
  "finished_at": "2026-08-11T13:59:01.785964+00:00",
  "source_last_modified": "2023-12-14T13:41:02.534142+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCF3/",
      "path": "/data/saxsdb/sasbdb/entries/f3/sasdcf3/source/summary.json",
      "size": 6721,
      "sha256": "8acb032f422b3749a19883875ffd4c40a00a85cb7fd9dc45be49ec42bae457e6"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCF3.dat",
      "path": "/data/saxsdb/sasbdb/entries/f3/sasdcf3/source/SASDCF3.dat",
      "size": 23850,
      "sha256": "7cb01fe70f30ea86fab7b8ef2cbc4d8118decc197fd4dee7fb59c0f29f60c432",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCF3.out",
      "path": "/data/saxsdb/sasbdb/entries/f3/sasdcf3/source/SASDCF3.out",
      "size": 21686,
      "sha256": "513f47a00f5154c6e426c4ca8ac6a120a32b10cc19644ff50bbaedb90b056e21",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCF3.sascif",
      "path": "/data/saxsdb/sasbdb/entries/f3/sasdcf3/source/SASDCF3.sascif",
      "size": 47064,
      "sha256": "1eb6689467e3e0bf72ed34b3b7c5d9a912ceb6bcf64204d114c00f81dff6ce91",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCF3.zip",
      "path": "/data/saxsdb/sasbdb/entries/f3/sasdcf3/source/SASDCF3.zip",
      "size": 15878,
      "sha256": "b69023e9ddba09a52e8010203efd33e3d54aa25de63649bba1aa5f5041c01110",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}