The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCH2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural Basis of Substrate Recognition by Aldehyde Dehydrogenase 7A1.",
"publication": {
"title": "Structural Basis of Substrate Recognition by Aldehyde Dehydrogenase 7A1.",
"author_list": "Luo M, Tanner JJ",
"journal": "Biochemistry",
"doi": "10.1021/acs.biochem.5b00754",
"pmid": "26260980",
"published_date": "2015 Sep 8"
},
"status": "released",
"submitted_date": "2016-10-05",
"released_date": "2017-04-03"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCH2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCH2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCH2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCH2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCH2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCH2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCH2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 165 CCD",
"resolution": null
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Aldehyde dehydrogenase 7A1 (Alpha-aminoadipic semialdehyde dehydrogenase)",
"short_name": "ALDH7A1",
"sequence": "GHMSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIP\r\nAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVG\r\nLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDER\r\nVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEV\r\nVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHT\r\nETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGR\r\nESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ",
"organism": "Homo sapiens",
"uniprot_code": "P49419",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWG\nGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDA\nLREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIE\nQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED\nNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN\nNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVG\nNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD\nASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI\nVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ",
"mw": 55.56,
"total_mw": 222.24,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris, 5% glycerol, 0.5 mM tris(3-hydroxypropyl)phosphine, 50 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "Aldehyde dehydrogenase 7A1",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "Mizzou",
"address": "Columbia, MO, USA",
"full_name": "University of Missouri-Columbia",
"webpage": "http://missouri.edu/"
}
],
"contributor_name": "John",
"contributor_surname": "Tanner",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-03-09",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.094,
"s_max": 3.189,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/4ZUKtetramer_img.png",
"software": "FoXS",
"pdb_link": [
{
"pdb_code": "4zuk",
"ext_code": "4ZUK",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCH2_fit1_model1.pdb",
"model_mw": 216.1,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "chains A, B, C, and D of PDB 4ZUK",
"user": 166
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCH2_fit1_fixed_fit_img.png",
"software": null,
"chi_square_value": 1.63,
"p_value": 0.0,
"fit_residual_plot": "SASDCH2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCH2_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM",
"i0_calibration_standard": null,
"description": "The FoXS fits have χ values of 1.5 for the tetramer, 12.4 for the dimer, and 1.2 for the 96%/4% tetramer/dimer ensemble.",
"experiment_description": "Synchrotron SAXS data from solutions of Aldehyde dehydrogenase 7A1 in 50 mM Tris, 5% glycerol, 0.5 mM tris(3-hydroxypropyl)phosphine, 50 mM NaCl, pH 7.8 were collected on the 12.3.1 (SIBYLS) camera on the storage ring Advanced Light Source (ALS) (Berkeley, CA, USA) via the mail-in program. Prior to data collection, an ALDH7A1 sample was passed through a Superdex 200 size exclusion column. Scattering intensities were measured at three nominal protein concentrations using exposure times of 0.5, 1.0, 3.0, and 6.0 s. Scattering curves collected from the protein samples were corrected for background scattering using intensity data collected from the Superdex 200 column effluent. Composite scattering curves for each protein concentration were generated with PRIMUS by scaling and merging the background-corrected high-s region from the 3 s exposure with the low-s region from the 0.5 or 1.0 s exposure.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 222.2,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 848.0,
"pddf_i0_error": 4.0,
"guinier_i0": 853.0,
"guinier_i0_error": 10.0,
"pddf_rg": 3.71,
"pddf_rg_error": 0.01,
"guinier_rg": 3.77,
"guinier_rg_error": 0.05,
"pddf_dmax": 11.5,
"pddf_dmax_error": 0.5,
"porod_volume": 270.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 40,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCH2_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-18T10:07:55.214115+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCH2",
"status": "success",
"started_at": "2026-08-11T13:38:43.422221+00:00",
"finished_at": "2026-08-11T13:38:53.376323+00:00",
"source_last_modified": "2026-05-18T10:07:55.214115+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCH2/",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdch2/source/summary.json",
"size": 8521,
"sha256": "dca0f4396e2ed2fa4a9c4ace1b3368beac9d70024c8d561dbecfc541bf639144"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCH2.dat",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdch2/source/SASDCH2.dat",
"size": 22493,
"sha256": "ab5c0b867566a09f9e1828dadeeffece5913a91e4443fe48384df7bc56d8dc9d",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCH2.out",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdch2/source/SASDCH2.out",
"size": 40331,
"sha256": "965b3b7c6068f266ef2568664e73e3618421c40e12889c533778285e3ab8d355",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCH2.sascif",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdch2/source/SASDCH2.sascif",
"size": 1567451,
"sha256": "e78293721034046c17426ee8a457df6fa079489dfb0a7db7fb4bb88fce4f2216",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCH2.zip",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdch2/source/SASDCH2.zip",
"size": 330815,
"sha256": "808b543c32fff8da7a84d9c38731898eb09b14eace927eac3f28576195f8254f",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
