The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCK3",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "High-resolution structure of the alcohol dehydrogenase domain of the bifunctional bacterial enzyme AdhE.",
"publication": {
"title": "High-resolution structure of the alcohol dehydrogenase domain of the bifunctional bacterial enzyme AdhE.",
"author_list": "Azmi L, Bragginton EC, Cadby IT, Byron O, Roe AJ, Lovering AL, Gabrielsen M",
"journal": "Acta Crystallogr F Struct Biol Commun",
"doi": "10.1107/S2053230X20010237",
"pmid": "32880589",
"published_date": "2020 Sep 1"
},
"status": "released",
"submitted_date": "2017-05-11",
"released_date": "2017-12-12"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCK3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCK3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCK3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCK3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCK3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCK3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCK3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Aldehyde-alcohol dehydrogenase",
"short_name": "AdhE",
"sequence": "MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG\r\nIVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA\r\nIFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA\r\nLMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF\r\nDNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP\r\nAYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV\r\nAMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG\r\nCGSWGGNSISENVGPKHLINKKTVAHHHHHH",
"organism": "Escherichia coli O157:H7",
"uniprot_code": "P0A9Q8",
"uniprot_range_first": 1,
"uniprot_range_last": 445,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG\nIVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA\nIFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA\nLMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF\nDNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP\nAYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV\nAMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG\nCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK\nRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI\nIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG\nTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME\nAYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG\nVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD\nHLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ\nCTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA",
"mw": 48.038,
"total_mw": 48.038,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "30 mM HEPES, 150 mM NaCl, 5% (v/v) glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Aldehyde dehydrogenase",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Glasgow, Scotland, UK",
"full_name": "University of Glasgow",
"webpage": "http://www.gla.ac.uk/"
}
],
"contributor_name": "Liyana",
"contributor_surname": "Azmi",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-01-30",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 1.0,
"number_of_frames": 18,
"wavelength": 0.1,
"sample_detector_distance": 4.04,
"concentration_min": null,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.04,
"s_max": 4.415,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCK3_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCK3_fit1_model1.pdb",
"model_mw": 46.2,
"bead_radius": 2.4,
"log": "https://www.sasbdb.org/media/log_files/D1-AdhE1_7.log",
"symmetry": "P1",
"comment": "",
"user": 193
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCK3_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.774,
"p_value": 0.4599,
"fit_residual_plot": "SASDCK3_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCK3_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/D1-AdhE1_7.log",
"software_version": "",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCK3_fit2_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.0 r9217",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCK3_fit2_model1.pdb",
"model_mw": 46.036,
"bead_radius": 2.5,
"log": null,
"symmetry": "P1",
"comment": "this is the averaged representation of the model",
"user": 193
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCK3_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.773,
"p_value": 0.4599,
"fit_residual_plot": "SASDCK3_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCK3_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/D1-AdhE1_7_Es14JHH.log",
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Aldehyde dehydrogenase (AldDH) is the N-terminal domain of the bifunctional alcohol/aldehyde dehydrogenase (AdhE; SASBDB entry SASDC72) spanning amino acids 1-445 of the full-length protein. SAXS data were measured from a protein construct that included a C-terminal 6 x histidine affinity chromatography tag. The buffer subtraction was performed using Scatter. Subsequent analysis was performed using PRIMUS (ATSAS 2.7.1).",
"experiment_description": "Synchrotron SAXS data from solutions of aldehyde dehydrogenase in 30 mM HEPES, 150 mM NaCl, 5% (v/v) glycerol, pH 7.5 were collected on the B21 camera at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 4.0 m and at a wavelength of λ = 0.1 nm ((Is) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 2.00 mg/ml was measured at 4°C. 18 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted to obtain the SAXS profile displayed in this entry.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 46.5,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 46.5,
"porod_mw_error": null,
"pddf_i0": 0.1826,
"pddf_i0_error": 0.0002068,
"guinier_i0": 0.18,
"guinier_i0_error": 0.00016,
"pddf_rg": 2.74,
"pddf_rg_error": 0.062,
"guinier_rg": 2.68,
"guinier_rg_error": 1.68,
"pddf_dmax": 11.1,
"pddf_dmax_error": null,
"porod_volume": 74.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 20,
"guinier_point_last": 182,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCK3_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-01-04T12:08:43.437315+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCK3",
"status": "success",
"started_at": "2026-08-11T16:35:36.065237+00:00",
"finished_at": "2026-08-11T16:35:50.235085+00:00",
"source_last_modified": "2021-01-04T12:08:43.437315+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCK3/",
"path": "/data/saxsdb/sasbdb/entries/k3/sasdck3/source/summary.json",
"size": 9993,
"sha256": "941c5d2601a45cf6003d684c33c0c2740ea8b0c0c07350c6c916cbf62afe274e"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCK3.dat",
"path": "/data/saxsdb/sasbdb/entries/k3/sasdck3/source/SASDCK3.dat",
"size": 81639,
"sha256": "8aea5592d0020dfa41934dcc17dc2a2b256a7d9cd74cc35c35452deec01bd695",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCK3.out",
"path": "/data/saxsdb/sasbdb/entries/k3/sasdck3/source/SASDCK3.out",
"size": 110009,
"sha256": "5617f73c05711ed49b317f4b93a2a6df5d02ac29f40448faa5f14246aaea389f",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCK3.sascif",
"path": "/data/saxsdb/sasbdb/entries/k3/sasdck3/source/SASDCK3.sascif",
"size": 523450,
"sha256": "0bbfdf8362359fdebef5b98c5ef0f217a5bcf925187ea7d6f3e4343be8e3cb68",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCK3.zip",
"path": "/data/saxsdb/sasbdb/entries/k3/sasdck3/source/SASDCK3.zip",
"size": 119622,
"sha256": "f283d50dc65dabb97b60725125a267498be9d69f03e6b8d12cffa56554f84015",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
