Horse myoglobin (WAXS)

{
  "code": "SASDCL8",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "WAXS benchmark on standard proteins",
    "publication": null,
    "status": "released",
    "submitted_date": "2017-10-17",
    "released_date": "2021-09-13"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCL8.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCL8_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCL8_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCL8_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCL8.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Custom-built",
        "name": "Pilatus 1M-W",
        "resolution": 0.172
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": "Point",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Myoglobin",
          "short_name": null,
          "sequence": ">sp|P68082|MYG_HORSE Myoglobin OS=Equus caballus GN=MB PE=1 SV=2\nMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE\nDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH\nPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG\n\n",
          "organism": "Equus caballus",
          "uniprot_code": "P68082",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE\nDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH\nPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG",
          "mw": 17.08,
          "total_mw": 17.0,
          "number_molecules": 1,
          "complex_state": null,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "100 mM tris pH 7.5, 100 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Horse myoglobin (WAXS)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "EMBL-Hamburg",
            "address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
            "full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
            "webpage": "http://www.embl-hamburg.de/index.php"
          }
        ],
        "contributor_name": "Maxim",
        "contributor_surname": "Petoukhov",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-06-02",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.2,
    "number_of_frames": 54,
    "wavelength": 0.062,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 5.2,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.199,
    "s_max": 25.559,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCL8_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "1npf",
              "ext_code": "1NPF",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCL8_fit1_model1.pdb",
          "model_mw": 17.71,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 102
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCL8_fit1_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 5.377,
      "p_value": 0.0,
      "fit_residual_plot": "SASDCL8_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCL8_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/1npf04.log",
      "software_version": "crysol 3.0",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of horse myoglobin (WAXS) in 100 mM Tris, 100 mM NaCl, pH 7.5 were collected on the EMBL-P12 beam line at the PETRA III storage ring  (Hamburg, Germany) using a Pilatus 1M-W detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.062 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 5.20 mg/ml was measured at 10°C. 54 successive 0.200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the data scaled to protein concentration.",
  "tags": [
    "benchmark"
  ],
  "intensity_unit": "arbitrary",
  "experimental_mw": 17.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 1068.23,
  "guinier_i0_error": 1.21,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 1.6,
  "guinier_rg_error": null,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 59,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCL8_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:18.120449+02:00",
  "bragg_peak": []
}

{
  "code": "SASDCL8",
  "status": "success",
  "started_at": "2026-08-11T15:55:33.786333+00:00",
  "finished_at": "2026-08-11T15:55:40.901546+00:00",
  "source_last_modified": "2023-06-21T07:56:18.120449+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCL8/",
      "path": "/data/saxsdb/sasbdb/entries/l8/sasdcl8/source/summary.json",
      "size": 7070,
      "sha256": "433b1318c17e2d4503479259b60b750a104e5cd7829da47603d125b4e7d1a046"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCL8.dat",
      "path": "/data/saxsdb/sasbdb/entries/l8/sasdcl8/source/SASDCL8.dat",
      "size": 130759,
      "sha256": "8dd4e84dd2c0ec73f5cdf53105ef0a2bcdfb4d672928f4d7dc037bb16a3a100d",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/l8/sasdcl8/source/SASDCL8.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCL8.sascif",
      "path": "/data/saxsdb/sasbdb/entries/l8/sasdcl8/source/SASDCL8.sascif",
      "size": 394368,
      "sha256": "7c12e57d07628fc853b4235a0f80fef067db54141f79e41e2ad676e617d5bc7f",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCL8.zip",
      "path": "/data/saxsdb/sasbdb/entries/l8/sasdcl8/source/SASDCL8.zip",
      "size": 103732,
      "sha256": "c7049b33d71c7ca2dbe2fa51df702249b4d8cc480c334a9e8cbbb23f997eb410",
      "role": "full_entry_zip",
      "zip_member_count": 3,
      "zip_validation": "central_directory_readable"
    }
  ]
}