The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCM3",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site.",
"publication": {
"title": "Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site.",
"author_list": "Köfinger J, Ragusa MJ, Lee IH, Hummer G, Hurley JH",
"journal": "Structure",
"doi": "10.1016/j.str.2015.02.012",
"pmid": "25817386",
"published_date": "2015 May 5"
},
"status": "released",
"submitted_date": "2017-05-18",
"released_date": "2017-05-05"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCM3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCM3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCM3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCM3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCM3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCM3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCM3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Autophagy-related protein 17",
"short_name": "Atg17",
"sequence": "MSDAATTIPSDEIDKLWNKARNQLVEAQVECEESLKILSKVRTEMDSSQKSRFKLKFILNCLVNQVEFFK\r\nNIMLEKCISTELIDNEWSKLVLVEIVNDVSYWQNEITTKMKILQGTKYDLTDDHSSLSDFICMDHVDILQ\r\nQKIDEIPIIKQQVTNIRQHYKSIKDRIENQLVAVKLKKLRTYFDSHFSRDSKNNLFKLLESDYVTELNEF\r\nENELADFLRSITDHFDKCTILKEQQIPLPDLKELFQIVKKDDTQLENIRELVFETGLEVKAFSKKVNETI\r\nSEIMDKIGGFHLLASKIVTELEKCEEYLSIFQKIANLVFVYKESCIKKIEQVQQLCEFYDKFKLGYKNLL\r\nRERDRRKATALQMEKILKECQEKLQALSDADLDQRQQFLLENGDYLPENIWPGYIDDMESMYSFEYSIHN\r\nVPN",
"organism": "Kluyveromyces lactis",
"uniprot_code": "Q6CS99",
"uniprot_range_first": 1,
"uniprot_range_last": 423,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSDAATTIPSDEIDKLWNKARNQLVEAQVECEESLKILSKVRTEMDSSQKSRFKLKFILN\nCLVNQVEFFKNIMLEKCISTELIDNEWSKLVLVEIVNDVSYWQNEITTKMKILQGTKYDL\nTDDHSSLSDFICMDHVDILQQKIDEIPIIKQQVTNIRQHYKSIKDRIENQLVAVKLKKLR\nTYFDSHFSRDSKNNLFKLLESDYVTELNEFENELADFLRSITDHFDKCTILKEQQIPLPD\nLKELFQIVKKDDTQLENIRELVFETGLEVKAFSKKVNETISEIMDKIGGFHLLASKIVTE\nLEKCEEYLSIFQKIANLVFVYKESCIKKIEQVQQLCEFYDKFKLGYKNLLRERDRRKATA\nLQMEKILKECQEKLQALSDADLDQRQQFLLENGDYLPENIWPGYIDDMESMYSFEYSIHN\nVPN",
"mw": 49.864,
"total_mw": 99.728,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Autophagy-related protein 29",
"short_name": null,
"sequence": "MNNDNTKVYVRVAGKRPENFVETKPFIWDSRRDKILWTKISKIDSLEDMDWQELGADLGAPEPFLKKRSY\r\nTLFQNQLKVLSNQID",
"organism": "Kluyveromyces lactis",
"uniprot_code": "Q6CTU8",
"uniprot_range_first": 1,
"uniprot_range_last": 85,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MNNDNTKVYVRVAGKRPENFVETKPFIWDSRRDKILWTKISKIDSLEDMDWQELGADLGA\nPEPFLKKRSYTLFQNQLKVLSNQIDVTSNTRSSSESRNSVDNNILQNLQASRIMNHKLDK\nTDNLANNQESSSELSNLSVSKSALEDALMDCLQL",
"mw": 10.031,
"total_mw": 20.062,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "KLLA0A10637p",
"short_name": "Atg31",
"sequence": "MESPVLLVKNANAATNASNLGLLGQKQNSYTVDENTWFLNNISFIFEDDDPSQHDEDQLDYENVIIIDSE\r\nPSGTVNNVEMLSERWQLLAFDQNPRDNCISLTVMNELSADLGQNTDISGLDNLSKLYHERNAQIRKLLDS\r\nIAP",
"organism": "Kluyveromyces lactis",
"uniprot_code": "Q6CX74",
"uniprot_range_first": 1,
"uniprot_range_last": 143,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MESPVLLVKNANAATNASNLGLLGQKQNSYTVDENTWFLNNISFIFEDDDPSQHDEDQLD\nYENVIIIDSEPSGTVNNVEMLSERWQLLAFDQNPRDNCISLTVMNELSADLGQNTDISGL\nDNLSKLYHERNAQIRKLLDSIAP",
"mw": 16.071,
"total_mw": 32.142,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 200 mM NaCl, 2% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Atg17-Atg31-Atg29 Subcomplex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Hanover, NH, USA",
"full_name": "Dartmouth College",
"webpage": "http://home.dartmouth.edu/"
}
],
"contributor_name": "Michael",
"contributor_surname": "Ragusa",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-12-10",
"storage_temperature": null,
"cell_temperature": 22.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": 1.0,
"concentration_max": 5.3,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.089,
"s_max": 2.719,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Atg17-Atg31-Atg29 Subcomplex in 20 mM Tris, 200 mM NaCl, 2% glycerol, pH 8 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a Pilatus3 X 2M detector (I(s) vs s, where s = 4πsin θ/λ and 2θ is the scattering angle). Solute concentrations ranging between 1 and 5.3 mg/ml were measured at 22°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 152.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 2368.0,
"pddf_i0_error": 82.0,
"guinier_i0": 2325.3,
"guinier_i0_error": 28.0,
"pddf_rg": 10.9,
"pddf_rg_error": 0.2,
"guinier_rg": 10.1,
"guinier_rg_error": 0.5,
"pddf_dmax": 34.0,
"pddf_dmax_error": null,
"porod_volume": 848.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 8,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCM3_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCM3",
"status": "success",
"started_at": "2026-08-11T14:03:18.323923+00:00",
"finished_at": "2026-08-11T14:03:27.569038+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCM3/",
"path": "/data/saxsdb/sasbdb/entries/m3/sasdcm3/source/summary.json",
"size": 8468,
"sha256": "f23bb3884402fe3f9865a5990f8cd03573287ab177c6a6232dbf199174aaef02"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCM3.dat",
"path": "/data/saxsdb/sasbdb/entries/m3/sasdcm3/source/SASDCM3.dat",
"size": 22526,
"sha256": "26c1a4146691ab31347fab9bf2ee7420f16e6a35d28cd6a7a10ae3dcca3c218d",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCM3.out",
"path": "/data/saxsdb/sasbdb/entries/m3/sasdcm3/source/SASDCM3.out",
"size": 18214,
"sha256": "98ab60ca5cfa9dbf748f49284b0749c07541dd0463430e6b004e559cc37aa0b3",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCM3.sascif",
"path": "/data/saxsdb/sasbdb/entries/m3/sasdcm3/source/SASDCM3.sascif",
"size": 46039,
"sha256": "e7cc12387147ea3a693ea69274a40852466f9455a951c80432e779fb0f0a3734",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCM3.zip",
"path": "/data/saxsdb/sasbdb/entries/m3/sasdcm3/source/SASDCM3.zip",
"size": 16347,
"sha256": "18f95ac2af0a4eaae590722810f6d567be5b9567db2a63c503d364f24bb48d4a",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
