Truncated monomeric Cytohesin-3 (Grp1; amino acids 63-399) E161A 6GS Arf6 Q67L His6 fusion protein

{
  "code": "SASDCN7",
  "status": "Published",
  "type_of_curve": "Other",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.",
    "publication": {
      "title": "Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.",
      "author_list": "Malaby AW, Das S, Chakravarthy S, Irving TC, Bilsel O, Lambright DG",
      "journal": "Structure",
      "doi": "10.1016/j.str.2017.11.019",
      "pmid": "29276036",
      "published_date": "2018 Jan 2"
    },
    "status": "released",
    "submitted_date": "2017-09-22",
    "released_date": "2018-01-02"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCN7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCN7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCN7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCN7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCN7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCN7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCN7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "MAR 165 CCD",
        "resolution": null
      },
      "name": "Advanced Photon Source (APS), Argonne National Laboratory",
      "city": "Lemont, IL",
      "country": "USA",
      "beamline_name": "BioCAT 18ID",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Grp1 63-399 E161A 6GS Arf6 Q67L His fusion protein",
          "short_name": null,
          "sequence": "MGHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGER\r\nDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVL\r\nSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSH\r\nKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKKGSGSGSGSGSGSGKVLSKIFGNKEMRILM\r\nLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVV\r\nDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATS\r\nGDGLYEGLTWLTSNYNHHHHHH",
          "organism": "Mus musculus",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": null,
          "mw": 61.834,
          "total_mw": 61.834,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl, 2 mM MgCl2, 0.1% 2-mercaptoethanol, 5% glycerol, 0.001 mM insitol 1,3,4,5-tetrakis phosphate",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Truncated monomeric Cytohesin-3 (Grp1; amino acids 63-399) E161A 6GS Arf6 Q67L His6 fusion protein",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "UMASS",
            "address": "Worcester, MA, USA",
            "full_name": "UMASS Medical School",
            "webpage": "https://www.umassmed.edu/"
          }
        ],
        "contributor_name": "David",
        "contributor_surname": "Lambright",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2013-11-15",
    "storage_temperature": null,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 1,
    "wavelength": 0.10332,
    "sample_detector_distance": 2.5,
    "concentration_min": 0.0,
    "concentration_max": 2.4,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.069,
    "s_max": 3.162,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "This experimental profile was derived from SEC-SAXS data collected at the BioCAT Sector 18-ID beamline at the Argonne National Laboratory Advanced Photon Source using a MAR 165 CCD detector.  The protein was equilibrated with a 1.2 molar excess of inositol 1,3,4,5-tetrakis phosphate (IP4), concentrated to 10 mg/ml, and injected in 0.1 ml onto a 3 ml Superdex-200 Increase column equilibrated with 20 mM Tris, pH 8.0, 150 mM NaCl, 2 mM MgCl2, 0.1% 2-mercaptoethanol, 5% glycerol, and 0.001 ml IP4.  SAXS data sets were acquired with 1 s exposures at 5 s intervals during elution at a flow rate of 0.25 ml/min.  Raw SAXS images were radially averaged on a log scale over the q range 0.00621-0.333 Å-1 and normalized by the incident beam intensity.  The protein scattering profile was reconstructed by singular value decomposition and linear combination (SVD-LC) as described in Malaby et al. (2015) Methods for analysis of size-exclusion chromatography-small angle X-ray scattering and reconstruction of protein scattering. J Appl Crystallogr 48: 1102-1113.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 67.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 67.0,
  "porod_mw_error": null,
  "pddf_i0": 1.01,
  "pddf_i0_error": 0.001,
  "guinier_i0": 1.01,
  "guinier_i0_error": 0.001,
  "pddf_rg": 3.43,
  "pddf_rg_error": 0.01,
  "guinier_rg": 3.37,
  "guinier_rg_error": 0.008,
  "pddf_dmax": 13.6,
  "pddf_dmax_error": 0.1,
  "porod_volume": 100.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 29,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCN7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDCN7",
  "status": "success",
  "started_at": "2026-08-11T15:34:29.236904+00:00",
  "finished_at": "2026-08-11T15:34:35.990692+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCN7/",
      "path": "/data/saxsdb/sasbdb/entries/n7/sasdcn7/source/summary.json",
      "size": 6999,
      "sha256": "90cc32d28a01ef594fbc307a185251ea3e01d67c0492503259ac1fc86d58d958"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCN7.dat",
      "path": "/data/saxsdb/sasbdb/entries/n7/sasdcn7/source/SASDCN7.dat",
      "size": 2344,
      "sha256": "820a5c2aec5d562d257b5880ff1d22015ae59c060fa3b7151384998f021df4d0",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCN7.out",
      "path": "/data/saxsdb/sasbdb/entries/n7/sasdcn7/source/SASDCN7.out",
      "size": 12421,
      "sha256": "861e769d46a6c12643baf21aaa527cf3701ab592715defaf9032cd0fa5e92f6d",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCN7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/n7/sasdcn7/source/SASDCN7.sascif",
      "size": 18234,
      "sha256": "8ba16295591e91dcfe788ea36a212d115759bf420d81e975848770d9df2d966a",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCN7.zip",
      "path": "/data/saxsdb/sasbdb/entries/n7/sasdcn7/source/SASDCN7.zip",
      "size": 4771,
      "sha256": "79e95fcc06177381ab7d1cb10efc40aef1c04ecf63449a95b36ecd094fa31471",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}