The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCR2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains.",
"publication": {
"title": "Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains.",
"author_list": "Lambert JP, Picaud S, Fujisawa T, Hou H, Savitsky P, Uusküla-Reimand L, Gupta GD, Abdouni H, Lin ZY, Tucholska M, Knight JDR, Gonzalez-Badillo B, St-Denis N, Newman JA, Stucki M, Pelletier L, Bandeira N, Wilson MD, Filippakopoulos P, Gingras AC",
"journal": "Mol Cell",
"doi": "10.1016/j.molcel.2018.11.006",
"pmid": "30554943",
"published_date": "2018 Dec 13"
},
"status": "released",
"submitted_date": "2017-04-12",
"released_date": "2018-09-10"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCR2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCR2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCR2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCR2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCR2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCR2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCR2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Bromodomain-containing protein 4",
"short_name": "BRD4",
"sequence": "SMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE",
"organism": "Homo sapiens",
"uniprot_code": "O60885",
"uniprot_range_first": 44,
"uniprot_range_last": 460,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT\nNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW\nNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG\nRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT\nVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI\nDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI\nLKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA\nDVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV\nAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE\nKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE\nSEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK\nPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE\nMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP\nPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP\nQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL\nPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP\nPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP\nHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT\nHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI\nKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG\nSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM\nRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM\nLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF",
"mw": 47.243,
"total_mw": 47.243,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES, 150 mM NaCl, 2% glycerol, 0.5 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Bromodomain-containing protein 4 (BRD4) tandem bromodomains",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Oxford, UK",
"full_name": "University of Oxford",
"webpage": "http://www.ox.ac.uk/"
}
],
"contributor_name": "Joseph",
"contributor_surname": "Newman",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-01-13",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 10.0,
"number_of_frames": 12,
"wavelength": 0.1,
"sample_detector_distance": 3.929,
"concentration_min": null,
"concentration_max": 13.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.04,
"s_max": 4.398,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCR2_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCR2_fit1_model1.pdb",
"model_mw": 44.18,
"bead_radius": 3.75,
"log": null,
"symmetry": "",
"comment": "",
"user": 208
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCR2_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.047,
"p_value": 0.027,
"fit_residual_plot": "SASDCR2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCR2_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/brd4-u001-slow.log",
"software_version": "",
"description": null
}
],
"estimated_volume_method": "DAMMIN",
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of BRD4 tandem bromodomains in 20 mM HEPES, 150 mM NaCl, 2% glycerol, 0.5 mM TCEP, pH 7.5 were collected on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 3.9 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). In-line continuous flow HPLC-SAXS was employed at 10°C with a sample injection concentration of 13 mg/ml onto a Shodex 404 column. 12 successive 10 second frames were collected through the HPLC-elution peak. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves underwent single-value decomposition to produce the average-median scattering data displayed in this entry.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 47.2,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 41.0,
"porod_mw_error": null,
"pddf_i0": 0.1053,
"pddf_i0_error": 0.000777,
"guinier_i0": 0.103524,
"guinier_i0_error": 0.00095,
"pddf_rg": 6.79,
"pddf_rg_error": 0.061,
"guinier_rg": 6.319,
"guinier_rg_error": 0.12,
"pddf_dmax": 22.0,
"pddf_dmax_error": null,
"porod_volume": 251.43,
"porod_volume_error": null,
"estimated_volume": 88.0,
"estimated_volume_error": null,
"guinier_point_first": 18,
"guinier_point_last": 69,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCR2_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCR2",
"status": "success",
"started_at": "2026-08-11T16:35:17.186741+00:00",
"finished_at": "2026-08-11T16:35:26.021610+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCR2/",
"path": "/data/saxsdb/sasbdb/entries/r2/sasdcr2/source/summary.json",
"size": 9120,
"sha256": "1ebd28375e68a0578376526f360281aa20b4d1fa7f95280a4e273fa883952cb5"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCR2.dat",
"path": "/data/saxsdb/sasbdb/entries/r2/sasdcr2/source/SASDCR2.dat",
"size": 73585,
"sha256": "451521fc2ec920205855269a003b325253a67e81d90ffc9c440875f1c69c1ef0",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCR2.out",
"path": "/data/saxsdb/sasbdb/entries/r2/sasdcr2/source/SASDCR2.out",
"size": 39283,
"sha256": "2b5702cd847841e72cc5209982ddcbce9536fce0579c43e22ab6ba6edb143c24",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCR2.sascif",
"path": "/data/saxsdb/sasbdb/entries/r2/sasdcr2/source/SASDCR2.sascif",
"size": 185500,
"sha256": "a8d436171f4275502de89a1735507a100d8591a93416e2ddadde61459e445816",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCR2.zip",
"path": "/data/saxsdb/sasbdb/entries/r2/sasdcr2/source/SASDCR2.zip",
"size": 43970,
"sha256": "bc35c5c355aacb9b80b1925e146d6c7d5541b2fc3c35b000b2bfdf743766f360",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
