Bromodomain-containing protein 2 (BRD2) tandem bromodomains

{
  "code": "SASDCT2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains.",
    "publication": {
      "title": "Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains.",
      "author_list": "Lambert JP, Picaud S, Fujisawa T, Hou H, Savitsky P, Uusküla-Reimand L, Gupta GD, Abdouni H, Lin ZY, Tucholska M, Knight JDR, Gonzalez-Badillo B, St-Denis N, Newman JA, Stucki M, Pelletier L, Bandeira N, Wilson MD, Filippakopoulos P, Gingras AC",
      "journal": "Mol Cell",
      "doi": "10.1016/j.molcel.2018.11.006",
      "pmid": "30554943",
      "published_date": "2018 Dec 13"
    },
    "status": "released",
    "submitted_date": "2017-04-12",
    "released_date": "2018-09-10"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCT2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCT2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCT2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCT2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Bromodomain-containing protein 2",
          "short_name": "BRD2",
          "sequence": "SMKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD",
          "organism": "Homo sapiens",
          "uniprot_code": "P25440",
          "uniprot_range_first": 71,
          "uniprot_range_last": 455,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN\nPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP\nMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM\nPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI\nPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA\nSPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL\nLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL\nMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES\nSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG\nPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL\nGPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE\nKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP\nVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS\nSDSSSSSSSSSSSDTSDSDSG",
          "mw": 43.431,
          "total_mw": 43.431,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 150 mM NaCl, 2% glycerol, 0.5 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Bromodomain-containing protein 2 (BRD2) tandem bromodomains",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Oxford, UK",
            "full_name": "University of Oxford",
            "webpage": "http://www.ox.ac.uk/"
          }
        ],
        "contributor_name": "Joseph",
        "contributor_surname": "Newman",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-01-13",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 10.0,
    "number_of_frames": 12,
    "wavelength": 0.1,
    "sample_detector_distance": 3.92,
    "concentration_min": null,
    "concentration_max": 13.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.04,
    "s_max": 4.398,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCT2_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCT2_fit1_model1.pdb",
          "model_mw": 40.41,
          "bead_radius": 4.25,
          "log": "https://www.sasbdb.org/media/log_files/brd2-run2-slow.log",
          "symmetry": "",
          "comment": "",
          "user": 208
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCT2_fit1_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 1.152,
      "p_value": 0.001662,
      "fit_residual_plot": "SASDCT2_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCT2_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/brd2-run2-slow.log",
      "software_version": "",
      "description": null
    }
  ],
  "estimated_volume_method": "DAMMIN",
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.6",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of BRD2 tandem bromodomains in 20 mM HEPES, 150 mM NaCl, 2% glycerol, 0.5 mM TCEP, pH 7.5 were collected on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 3.9 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). In-line continuous flow HPLC-SAXS was employed at 10°C with a sample injection concentration of 13 mg/ml onto a Shodex 404 column. 12 successive 10 second frames were collected through the HPLC-elution peak. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves underwent single-value decomposition to produce the average-median scattering data displayed in this entry.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 43.4,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 39.0,
  "porod_mw_error": null,
  "pddf_i0": 0.0975,
  "pddf_i0_error": 0.0007,
  "guinier_i0": 0.09,
  "guinier_i0_error": 0.0014,
  "pddf_rg": 6.24,
  "pddf_rg_error": 0.055,
  "guinier_rg": 5.71,
  "guinier_rg_error": 0.72,
  "pddf_dmax": 21.0,
  "pddf_dmax_error": null,
  "porod_volume": 220.0,
  "porod_volume_error": null,
  "estimated_volume": 81.0,
  "estimated_volume_error": null,
  "guinier_point_first": 33,
  "guinier_point_last": 77,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCT2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDCT2",
  "status": "success",
  "started_at": "2026-08-11T16:24:34.617086+00:00",
  "finished_at": "2026-08-11T16:24:43.364260+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCT2/",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdct2/source/summary.json",
      "size": 8557,
      "sha256": "37e77ab6800a00fd4dc503b9cb7f5e07ae9fb97587d26c736c22fe2bd01481c7"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCT2.dat",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdct2/source/SASDCT2.dat",
      "size": 73570,
      "sha256": "e83a72c743a1527cc61dbdb5ba3da8a7ae2b7b4e77126f67e3268d8d9370ecc8",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCT2.out",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdct2/source/SASDCT2.out",
      "size": 38914,
      "sha256": "09446b6de24f1333b8de29ed402f76ef8e9529d1ac37f3e93dc3feba5f9a74a1",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCT2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdct2/source/SASDCT2.sascif",
      "size": 174901,
      "sha256": "bbad13618f6b76d973210b209fe129b5a3ef2cf7afe4d6228508aaae837b25b2",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCT2.zip",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdct2/source/SASDCT2.zip",
      "size": 43263,
      "sha256": "74590915447174775a464e10fb892162624d9c5d1a1346899c695076809133ce",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}