The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCT8",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/nm",
"project": {
"title": "Prp19/Pso4 Is an Autoinhibited Ubiquitin Ligase Activated by Stepwise Assembly of Three Splicing Factors.",
"publication": {
"title": "Prp19/Pso4 Is an Autoinhibited Ubiquitin Ligase Activated by Stepwise Assembly of Three Splicing Factors.",
"author_list": "de Moura TR, Mozaffari-Jovin S, Szabó CZK, Schmitzová J, Dybkov O, Cretu C, Kachala M, Svergun D, Urlaub H, Lührmann R, Pena V",
"journal": "Mol Cell",
"doi": "10.1016/j.molcel.2018.02.022",
"pmid": "29547724",
"published_date": "2018 Mar 15"
},
"status": "released",
"submitted_date": "2017-11-06",
"released_date": "2018-03-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCT8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCT8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCT8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCT8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCT8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "hypothetical protein CTHT_0072540",
"short_name": null,
"sequence": "MLCALSGEIPEEPVVSKKTGVLFEKRLILKYLEEHNNIEPGTTEELDPETDLLPIKTSRVVRPRPPNFTSIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARLTRERDEAREALARLTV",
"organism": "Chaetomium thermophilum",
"uniprot_code": "G0SFY0",
"uniprot_range_first": 1,
"uniprot_range_last": 136,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MLCALSGEIPEEPVVSKKTGVLFEKRLILKYLEEHNNIEPGTTEELDPETDLLPIKTSRV\nVRPRPPNFTSIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARL\nTRERDEAREALARLTVTGAAPAAQNGEAMAVDSESLSEGLVEHVNEVQQQLMKTRKKRPI\nPQGWATADDVAALQQVAYTDLNVTQASSLDLENECAAVGGLDGKLDIYSVVANKVERTLD\nIGEPVTATEWTGTKVVIGTAKGWVKVYDAGRESATFQTHAGPVTGLAVHPGGRILASVGV\nDKSFVFYDLETGERVARGYADAALTTCAFHPDGNLFAAGTQTGHILVFHTTTLEQAESFP\nLGTPIQALAFSENGFWFAATGKGTSSVTIFDLRKSGAAAAVKELQTGEVLSISWDYTGQY\nLATGGGTGVTVQMYTKATKSWSEPVRLGMPVVGVKWGGEAKRLVVVSREGVVSVLGKKEE",
"mw": 15.552,
"total_mw": 62.206,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES, 100 mM NaCl, 2 mM β-mercaptoethanol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Uncharacterized protein CTHT_0072540 (Core) from Chaetomium thermophilum",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Tales",
"contributor_surname": "Rocha de Moura",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-07-30",
"storage_temperature": null,
"cell_temperature": 25.0,
"exposure_time": 1.0,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.1,
"concentration_min": 1.3,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.028,
"s_max": 4.45,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCT8_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCT8_fit1_model1.pdb",
"model_mw": 40.025,
"bead_radius": 2.75,
"log": null,
"symmetry": "",
"comment": "",
"user": 227
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCT8_fit1_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.041,
"p_value": 0.02469,
"fit_residual_plot": "SASDCT8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCT8_fit1.fir",
"fit_log": null,
"software_version": "",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCT8_fit2_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCT8_fit2_model1.pdb",
"model_mw": 54.08,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 227
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCT8_fit2_fit_img.png",
"software": "SASREF",
"chi_square_value": 1.475,
"p_value": 0.012654,
"fit_residual_plot": "fit4columns966_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCT8_fit2.fit",
"fit_log": null,
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of uncharacterized protein CTHT_0072540 (Core) from Chaetomium thermophilum in 20 mM HEPES, 100 mM NaCl, 2 mM β-mercaptoethanol, pH 7.5, were collected on the P12 beam line at the PETRAIII the storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3.1 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 1.3 and 5 mg/ml were measured at 25°C. 20 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 55.5,
"experimental_mw_error": null,
"guinier_i0_mw": 90.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 2398.0,
"pddf_i0_error": 14.9,
"guinier_i0": 2368.95,
"guinier_i0_error": 15.4,
"pddf_rg": 4.313,
"pddf_rg_error": 0.045,
"guinier_rg": 4.09,
"guinier_rg_error": 0.04,
"pddf_dmax": 16.2,
"pddf_dmax_error": 1.5,
"porod_volume": 145.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 31,
"guinier_point_last": 108,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCT8_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
