The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCV8",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Prp19/Pso4 Is an Autoinhibited Ubiquitin Ligase Activated by Stepwise Assembly of Three Splicing Factors.",
"publication": {
"title": "Prp19/Pso4 Is an Autoinhibited Ubiquitin Ligase Activated by Stepwise Assembly of Three Splicing Factors.",
"author_list": "de Moura TR, Mozaffari-Jovin S, Szabó CZK, Schmitzová J, Dybkov O, Cretu C, Kachala M, Svergun D, Urlaub H, Lührmann R, Pena V",
"journal": "Mol Cell",
"doi": "10.1016/j.molcel.2018.02.022",
"pmid": "29547724",
"published_date": "2018 Mar 15"
},
"status": "released",
"submitted_date": "2017-11-06",
"released_date": "2018-03-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCV8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCV8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCV8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCV8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCV8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCV8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCV8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "MAX IV",
"city": "Lund",
"country": "Sweden",
"beamline_name": "I911-4",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Full-length hypothetical protein CTHT_0072540",
"short_name": null,
"sequence": "MLCALSGEIPEEPVVSKKTGVLFEKRLILKYLEEHNNIEPGTTEELDPETDLLPIKTSRVVRPRPPNFTS\r\nIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARLTRERDEAREALARLTVTGAA\r\nPAAQNGEAMAVDSESLSEGLVEHVNEVQQQLMKTRKKRPIPQGWATADDVAALQQVAYTDLNVTQASSLD\r\nLENECAAVGGLDGKLDIYSVVANKVERTLDIGEPVTATEWTGTKVVIGTAKGWVKVYDAGRESATFQTHA\r\nGPVTGLAVHPGGRILASVGVDKSFVFYDLETGERVARGYADAALTTCAFHPDGNLFAAGTQTGHILVFHT\r\nTTLEQAESFPLGTPIQALAFSENGFWFAATGKGTSSVTIFDLRKSGAAAAVKELQTGEVLSISWDYTGQY\r\nLATGGGTGVTVQMYTKATKSWSEPVRLGMPVVGVKWGGEAKRLVVVSREGVVSVLGKKEE",
"organism": "Chaetomium thermophilum",
"uniprot_code": "G0SFY0",
"uniprot_range_first": 1,
"uniprot_range_last": 480,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MLCALSGEIPEEPVVSKKTGVLFEKRLILKYLEEHNNIEPGTTEELDPETDLLPIKTSRV\nVRPRPPNFTSIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARL\nTRERDEAREALARLTVTGAAPAAQNGEAMAVDSESLSEGLVEHVNEVQQQLMKTRKKRPI\nPQGWATADDVAALQQVAYTDLNVTQASSLDLENECAAVGGLDGKLDIYSVVANKVERTLD\nIGEPVTATEWTGTKVVIGTAKGWVKVYDAGRESATFQTHAGPVTGLAVHPGGRILASVGV\nDKSFVFYDLETGERVARGYADAALTTCAFHPDGNLFAAGTQTGHILVFHTTTLEQAESFP\nLGTPIQALAFSENGFWFAATGKGTSSVTIFDLRKSGAAAAVKELQTGEVLSISWDYTGQY\nLATGGGTGVTVQMYTKATKSWSEPVRLGMPVVGVKWGGEAKRLVVVSREGVVSVLGKKEE",
"mw": 51.788,
"total_mw": 207.152,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES, 100 mM NaCl, 2 mM β-mercaptoethanol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Uncharacterized protein CTHT_0072540 (Prp19 full-length) from Chaetomium thermophilum",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Tales",
"contributor_surname": "Rocha de Moura",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-10-15",
"storage_temperature": null,
"cell_temperature": 25.0,
"exposure_time": 120.0,
"number_of_frames": null,
"wavelength": 0.091,
"sample_detector_distance": 2.2,
"concentration_min": 0.6,
"concentration_max": 4.4,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.142,
"s_max": 2.998,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCV8_fit1_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCV8_fit1_model1.pdb",
"model_mw": 191.5,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 227
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCV8_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.555,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1041_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCV8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCV8_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "r9988",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCV8_fit2_model1.pdb",
"model_mw": 136.0,
"bead_radius": 3.6,
"log": null,
"symmetry": null,
"comment": null,
"user": 227
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCV8_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.003,
"p_value": 0.03,
"fit_residual_plot": "SASDCV8_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCV8_fit2.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Uncharacterized protein CTHT_0072540 (Prp19 full-length) from Chaetomium thermophilum in 20 mM HEPES, 100 mM NaCl, 2 mM β-mercaptoethanol, pH 7.5, were collected on the I911-4 beam line at the MAX IV storage ring (Lund, Sweden) using a Pilatus 1M detector at the wavelength λ = 0.091 nm and a sample-detector distance of 2.2 m (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 0.6 and 4.4 mg/ml were measured at 25°C with an exposure time of 120 seconds. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 220.0,
"experimental_mw_error": null,
"guinier_i0_mw": 220.0,
"guinier_i0_mw_error": null,
"porod_mw": 175.0,
"porod_mw_error": null,
"pddf_i0": 0.0008299,
"pddf_i0_error": 1.6e-05,
"guinier_i0": 0.00084,
"guinier_i0_error": 6.7e-05,
"pddf_rg": 6.73,
"pddf_rg_error": 0.097,
"guinier_rg": 6.24,
"guinier_rg_error": 0.54,
"pddf_dmax": 23.0,
"pddf_dmax_error": 3.6,
"porod_volume": 280.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 13,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCV8_datloglog_img.png",
"symmetry": null,
"last_modified": "2022-03-31T22:16:50.216184+02:00",
"bragg_peak": []
}
