Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP.VO4+OM

{
  "code": "SASDCW4",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil.",
    "publication": {
      "title": "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil.",
      "author_list": "Planelles-Herrero VJ, Hartman JJ, Robert-Paganin J, Malik FI, Houdusse A",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-017-00176-5",
      "pmid": "28775348",
      "published_date": "2017 Aug 4"
    },
    "status": "released",
    "submitted_date": "2017-06-07",
    "released_date": "2018-01-23"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCW4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCW4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCW4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "CCD",
        "name": "AVIEX PCCD170170",
        "resolution": null
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Bovine β Cardiac Myosin S1 fragment",
          "short_name": "BCS1 (myosin-7)",
          "sequence": "MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT\r\nAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL\r\nFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES\r\nGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN\r\nSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM\r\nLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG\r\nNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV\r\nVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF\r\nTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF\r\nPKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP\r\nLNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT\r\nNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ\r\nRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER\r\nLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWP\r\nMAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE\r\nAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP\r\nMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ\r\nEDSNGCINYEAFVKHIMAG",
          "organism": "Bos taurus",
          "uniprot_code": "Q9BE39",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT\nAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL\nFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES\nGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN\nSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM\nLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG\nNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV\nVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF\nTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF\nPKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP\nLNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT\nNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ\nRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER\nLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL\nKSAETEKEIALMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD\nAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT\nLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL\nTKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL\nKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS\nRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV\nAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR\nSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE\nEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI\nQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA\nALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR\nENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEQEEGKILR\nAQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG\nDLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL\nLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTE\nVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA\nEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN\nLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL\nRAKSRDIGTKGLNEE",
          "mw": 116.582,
          "total_mw": 116.582,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "10 mM HEPES, 50 mM NaCl, 1 mM NaN3, 2.5 mM MgCl2, 2 mM ADP, 1 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP.VO4+OM",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Paris, France",
            "full_name": "Institut Curie",
            "webpage": "https://institut-curie.org/"
          }
        ],
        "contributor_name": "Vicente José",
        "contributor_surname": "Planelles Herrero",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2016-03-01",
    "storage_temperature": 4.0,
    "cell_temperature": null,
    "exposure_time": 0.5,
    "number_of_frames": 41,
    "wavelength": 0.10332,
    "sample_detector_distance": 1.786,
    "concentration_min": null,
    "concentration_max": 4.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.199,
    "s_max": 6.14,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "BATCH mode",
  "experiment_description": "Synchrotron SAXS data from solutions of Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP.VO4+OM in 10 mM HEPES, 50 mM NaCl, 1 mM NaN3, 2.5 mM MgCl2, 2 mM ADP, 1 mM TCEP, pH 7.5 were collected on the SWING beam line at SOLEIL (Saint-Aubin, France) using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.10332 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 4.00 mg/ml was measured. 41 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 112.91,
  "experimental_mw_error": null,
  "guinier_i0_mw": 112.91,
  "guinier_i0_mw_error": null,
  "porod_mw": 100.0,
  "porod_mw_error": null,
  "pddf_i0": 0.1495,
  "pddf_i0_error": 0.0006,
  "guinier_i0": 0.15,
  "guinier_i0_error": 4.8e-05,
  "pddf_rg": 3.68,
  "pddf_rg_error": 0.002,
  "guinier_rg": 3.6,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 12.6,
  "pddf_dmax_error": null,
  "porod_volume": 162.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 29,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCW4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDCW4",
  "status": "success",
  "started_at": "2026-08-11T14:32:49.954831+00:00",
  "finished_at": "2026-08-11T14:32:57.295063+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCW4/",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdcw4/source/summary.json",
      "size": 9065,
      "sha256": "2d80ab023b95dc918601654d1f7b564ff87ae6b93c95ee1de8b8f394434cfc8c"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCW4.dat",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdcw4/source/SASDCW4.dat",
      "size": 29430,
      "sha256": "d96d113afac0c9a0bb86ae9bf011094c1bca20d8518c909393e449217f3b8932",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCW4.out",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdcw4/source/SASDCW4.out",
      "size": 29303,
      "sha256": "fbe265542f0105435fd325c784a03c4e43a39801d9b47981788abd546a73d627",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdcw4/source/SASDCW4.sascif",
      "size": 81966,
      "sha256": "24c84ad4241ed24f49c8d0bf11c186fa43692965cf92142cfab4ab8aa60c235f",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCW4.zip",
      "path": "/data/saxsdb/sasbdb/entries/w4/sasdcw4/source/SASDCW4.zip",
      "size": 12333,
      "sha256": "525d9de12ca568c35c0f46eadd0c53fd720ac396efea5c742ca3a8eb4401ff52",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}