Chd1-12N12, chromatin remodeler--nucleosome complex, in 60% sucrose with AMP-PNP

{
  "code": "SASDCW6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The ATPase motor of the Chd1 chromatin remodeler stimulates DNA unwrapping from the nucleosome.",
    "publication": {
      "title": "The ATPase motor of the Chd1 chromatin remodeler stimulates DNA unwrapping from the nucleosome.",
      "author_list": "Tokuda JM, Ren R, Levendosky RF, Tay RJ, Yan M, Pollack L, Bowman GD",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gky206",
      "pmid": "29850894",
      "published_date": "2018 Jun 1"
    },
    "status": "released",
    "submitted_date": "2017-08-03",
    "released_date": "2018-03-25"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCW6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCW6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCW6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Pilatus",
        "name": "Pilatus 200K",
        "resolution": 172.0
      },
      "name": "Cornell High Energy Synchrotron Source (CHESS)",
      "city": "Ithaca, NY",
      "country": "USA",
      "beamline_name": "G1",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Chromodomain-helicase-DNA-binding protein 1",
          "short_name": "Chd1",
          "sequence": "GPQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEENVH\r\nEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLI\r\nKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAE\r\nDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLN\r\nYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLS\r\nVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFI\r\nSWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDT\r\nIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEA\r\nHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT\r\nIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILR\r\nVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF\r\nDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVL\r\nIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDF\r\nVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVM\r\nVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGEL\r\nSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGE\r\nEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQLEMMN\r\nRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEV\r\nRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVH\r\nEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREK\r\nKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTP\r\nKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLNEV\r\nHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLR\r\nGGLNTKSPS",
          "organism": "Saccharomyces cerevisiae",
          "uniprot_code": "P32657",
          "uniprot_range_first": 118,
          "uniprot_range_last": 1274,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDE\nDEFEDEEGEEDSGEDEDEEDFEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQST\nVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEENVHEASANPQPEDFHGID\nIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK\nRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLED\nGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR\nFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF\nARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK\nKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI\nTGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK\nDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN\nHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM\nVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL\nMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE\nYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAED\nHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ\nLEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYK\nAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEK\nHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDL\nKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD\nDPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYL\nLSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMK\nALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRH\nTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS\nYSANFWPADVKSTKLMAMYDKITESQKK",
          "mw": 133.115,
          "total_mw": 266.23,
          "number_molecules": 2,
          "complex_state": true,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "169 bp DNA (145 bp Widom 601, flanked by 12bp DNA)",
          "short_name": "DNA",
          "sequence": "CTTTCAGCTGATATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATCTTGATATCAGCTGAAAG",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "DNA",
          "uniprot_sequence": null,
          "mw": 52.468,
          "total_mw": 52.468,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H2A type 1",
          "short_name": "H2A",
          "sequence": "MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT\r\nAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKK\r\nTESAKSAKSK",
          "organism": "Xenopus laevis",
          "uniprot_code": "P06897",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT\nAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKK\nTESAKSAKSK",
          "mw": 13.966,
          "total_mw": 13.966,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H2B 1.1",
          "short_name": "H2B",
          "sequence": "MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAM\r\nSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT\r\nKYTSAK",
          "organism": "Xenopus laevis",
          "uniprot_code": "P02281",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAM\nSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT\nKYTSAK",
          "mw": 13.934,
          "total_mw": 13.934,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H3.2",
          "short_name": "H3",
          "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE\r\nLLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI\r\nMPKDIQLARRIRGERA",
          "organism": "Xenopus laevis",
          "uniprot_code": "P84233",
          "uniprot_range_first": 1,
          "uniprot_range_last": 136,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE\nLLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI\nMPKDIQLARRIRGERA",
          "mw": 15.388,
          "total_mw": 15.388,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H4",
          "short_name": "H4",
          "sequence": "MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK\r\nVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG",
          "organism": "Xenopus laevis",
          "uniprot_code": "P62799",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK\nVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG",
          "mw": 11.367,
          "total_mw": 11.367,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "10 mM Tris, 100 mM NaCl, 2 mM MgCl2, 0.1 mM EDTA, 1 mM DTT, 60% (w/v) sucrose, 0.5 mM AMP-PNP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Chd1-12N12, chromatin remodeler--nucleosome complex, in 60% sucrose with AMP-PNP",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Ithaca, NY, United States",
            "full_name": "Cornell University",
            "webpage": "https://www.cornell.edu/"
          }
        ],
        "contributor_name": "Joshua",
        "contributor_surname": "Tokuda",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-10-24",
    "storage_temperature": 25.0,
    "cell_temperature": 25.0,
    "exposure_time": 10.0,
    "number_of_frames": 40,
    "wavelength": 0.1109,
    "sample_detector_distance": 2.08,
    "concentration_min": null,
    "concentration_max": 1.88,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.16,
    "s_max": 2.6,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model1_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model1.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model2_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model2.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model3_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model3.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model4_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model4.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model5_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model5.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model6_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model6.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model7_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model7.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model8_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model8.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model9_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model9.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model10_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model10.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model11_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model11.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model12_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model12.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model13_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model13.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model14_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model14.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model15_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model15.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model16_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model16.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW6_fit1_model17_img.png",
          "software": "Custom in-house",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW6_fit1_model17.pdb",
          "model_mw": 100.1,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": "Generated using 3D-DART and custom scripts written in Pymol.  Percentage represents ensemble weight.",
          "user": 170
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCW6_fit1_fixed_fit_img.png",
      "software": "EOM/GAJOE",
      "chi_square_value": 0.87,
      "p_value": 0.6841,
      "fit_residual_plot": "fit4columns1049_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCW6_fit1.fit",
      "fit_log": null,
      "software_version": "",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "Version 5.0 (r4547)",
  "i0_calibration_standard": null,
  "description": "12N12 nucleosomes in the presence of the chromatin remodeler Chd1 in 60% sucrose and AMP-PNP.\r\nThe complex formed contains two Chd1 proteins bound to each nucleosome. Due to contrast matching between the solvent and histone proteins, the measured signal is dominated by the DNA component. The models were generated using 3D-DART and custom scripts written in Pymol. The percentage-weighting of each model in the ensemble ('XXXperc') is noted in the following model key/list that sequentially corresponds to models displayed in this entry ordered from top-to-bottom: --------------------------------------------------------------------------------------------------------\r\n--------------SASDCW6_fit1_model1=Chd1_12N12_AMP_01_wrapped_25perc;  \r\n--------------SASDCW6_fit1_model2=Chd1_12N12_AMP_02_wrapped_01perc;  \r\n--------------SASDCW6_fit1_model3=Chd1_12N12_AMP_03_wrapped_01perc;  \r\n--------------SASDCW6_fit1_model4=Chd1_12N12_AMP_04_extreme_02perc;  \r\n--------------SASDCW6_fit1_model5=Chd1_12N12_AMP_05_extreme_01perc;  \r\n--------------SASDCW6_fit1_model6=Chd1_12N12_AMP_06_inplane_01perc;  \r\n--------------SASDCW6_fit1_model7=Chd1_12N12_AMP_07_inplane_11perc;  \r\n--------------SASDCW6_fit1_model8=Chd1_12N12_AMP_08_inplane_08perc;  \r\n--------------SASDCW6_fit1_model9=Chd1_12N12_AMP_09_inplane_03perc;  \r\n--------------SASDCW6_fit1_model10=Chd1_12N12_AMP_10_inplane_12perc;  \r\n--------------SASDCW6_fit1_model11=Chd1_12N12_AMP_11_inplane_01perc;  \r\n--------------SASDCW6_fit1_model12=Chd1_12N12_AMP_12_inplane_03perc_dyadfliip;  \r\n--------------SASDCW6_fit1_model13=Chd1_12N12_AMP_13_inplane_12perc_dyadflip;  \r\n--------------SASDCW6_fit1_model14=Chd1_12N12_AMP_14_inplane_01perc_dyadflip;  \r\n--------------SASDCW6_fit1_model15=Chd1_12N12_AMP_15_inplane_01perc_dyadflip;  \r\n--------------SASDCW6_fit1_model16=Chd1_12N12_AMP_16_inplane_15perc;  \r\n--------------SASDCW6_fit1_model17=Chd1_12N12_AMP_17_inplane_02perc.",
  "experiment_description": "Synchrotron SAXS data from solutions of Chd1-12N12, chromatin remodeler--nucleosome complex, in 10 mM Tris, 100 mM NaCl, 2 mM MgCl2, 0.1 mM EDTA, 1 mM DTT, 60% (w/v) sucrose, 0.5 mM AMP-PNP, pH 7.8, were collected on the G1 beam line at the Cornell High Energy Synchrotron Source (Ithaca, NY, USA) using a Pilatus Pilatus 200K detector at a sample-detector distance of 2.1 m and at a wavelength of λ = 0.1109 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 1.88 mg/ml was measured at 25°C. 40 successive 10 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted to produce the scattering profile displayed in this entry.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 105.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.02122,
  "pddf_i0_error": 0.00017,
  "guinier_i0": 0.0216,
  "guinier_i0_error": 0.00037,
  "pddf_rg": 5.527,
  "pddf_rg_error": 0.049,
  "guinier_rg": 5.619,
  "guinier_rg_error": 0.119,
  "pddf_dmax": 16.7,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 8,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCW6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-08-18T17:30:42.937574+02:00",
  "bragg_peak": []
}

{
  "code": "SASDCW6",
  "status": "success",
  "started_at": "2026-08-11T15:17:09.443374+00:00",
  "finished_at": "2026-08-11T15:17:20.800624+00:00",
  "source_last_modified": "2021-08-18T17:30:42.937574+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCW6/",
      "path": "/data/saxsdb/sasbdb/entries/w6/sasdcw6/source/summary.json",
      "size": 26538,
      "sha256": "58308419875f7c50d6c8d6a77eafe2919cc6fc010582693e58c75e9b1fdf4584"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCW6.dat",
      "path": "/data/saxsdb/sasbdb/entries/w6/sasdcw6/source/SASDCW6.dat",
      "size": 14988,
      "sha256": "28cf5fab1a67dbecbf473a65698ed9324774a0c415ce7030032a998bfc30d177",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCW6.out",
      "path": "/data/saxsdb/sasbdb/entries/w6/sasdcw6/source/SASDCW6.out",
      "size": 27330,
      "sha256": "5d95d2bf1228a02d75f59ba25bbe781ef4ce066a4b5db2be5b4e6dd7e50e7c0c",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/w6/sasdcw6/source/SASDCW6.sascif",
      "size": 9197,
      "sha256": "a1dbdd262183d80c2b32a4c1c091b076372542c972f468f542ed302b39a63fad",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCW6.zip",
      "path": "/data/saxsdb/sasbdb/entries/w6/sasdcw6/source/SASDCW6.zip",
      "size": 1976442,
      "sha256": "ae03d8239ac7ce4bdb5e7cf81db48d37611c2b2c2c24c93ccbc605031df35009",
      "role": "full_entry_zip",
      "zip_member_count": 21,
      "zip_validation": "central_directory_readable"
    }
  ]
}