The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCW7",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Design of coiled-coil protein-origami cages that self-assemble in vitro and in vivo.",
"publication": {
"title": "Design of coiled-coil protein-origami cages that self-assemble in vitro and in vivo.",
"author_list": "Ljubetič A, Lapenta F, Gradišar H, Drobnak I, Aupič J, Strmšek Ž, Lainšček D, Hafner-Bratkovič I, Majerle A, Krivec N, Benčina M, Pisanski T, Veličković TĆ, Round A, Carazo JM, Melero R, Jerala R",
"journal": "Nat Biotechnol",
"doi": "10.1038/nbt.3994",
"pmid": "29035374",
"published_date": "2017 Nov"
},
"status": "released",
"submitted_date": "2017-09-28",
"released_date": "2017-10-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCW7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCW7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCW7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCW7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "TET12(1.10)S-f5",
"short_name": "TET12S",
"sequence": "MLEEELKQLEEELQAIEEQLAQLQWKAQARKEKLAQLKEKLSGPGSPEDEIQQLEEEISQLEQKNSQLKEKNQQLKYGSGPGDIEQELERAKQSIRRLEQEVNQERSRMQYLQTLLSKSGPGQLEDKVEELLSKNYHLENEVSRLKKLVGSGPGLEEELKQLEEELQAIEEQLAQLQWKAQARKEKLAQLKEKLSGPGSPEDEIQSLEEKNSQLKQEISQLEEKNQQLKYGSGPGQLEDKVEELLSKNYHLENEVSRLKKLVGSGPGSPEDKISQLKQKIQQLKQENQQLEEENSQLEYGSGPGSPEDENSQLEEKISQLKQKNSQLKEEIQQLEYGSGPGSPEDKISQLKEENQQLEQKIQQLKEENSQLEYGSGPGDIEQELERAKQSIRRLEQEVNQERSRMQYLQTLLSKSGPGSPEDKNSQLKEEIQQLEEENQQLEEKISQLKYGLEHHHHHHHH",
"organism": "synthetic construct",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 53.191,
"total_mw": 53.191,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris 150 mM NaCl 10% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "TET12(1.10)S-f5",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "National Research Council",
"webpage": null
}
],
"contributor_name": "Jana",
"contributor_surname": "Aupič",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-04-07",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 2.0,
"number_of_frames": 10,
"wavelength": 0.1,
"sample_detector_distance": 2.89,
"concentration_min": 0.7,
"concentration_max": 6.3,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.122,
"s_max": 4.946,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCW7_fit1_model1_img.png",
"software": "MODELLER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "9.16",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCW7_fit1_model1.pdb",
"model_mw": 53.16,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 201
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCW7_fit1_fit_img.png",
"software": "Other",
"chi_square_value": 3.0,
"p_value": 0.0,
"fit_residual_plot": "SASDCW7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCW7_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/TET-S.log",
"software_version": "PepsiSAXS",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of TET12S in 20 mM Tris, 150 mM NaCl, 10% glycerol, pH 7.5, were collected at the BM29 beam line at the ESRF storage ring (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.89 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, where 2θ is the scattering angle). A solute concentration series ranging between 0.7 and 6.3 mg/ml were measured at 20°C. For each sample, data was collected over 10 frames lasting 2 s. The data were normalized to the intensity of the transmitted beam and radially averaged. Each individual frames were carefully inspected for radiation damage and those not showing any radiation damage were then averaged. The scattering of the matched solvent-blank was subtracted and the different curves were scaled for protein concentration. Scattering curves were merged and analyzed using PRIMUS software.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 53.7,
"experimental_mw_error": null,
"guinier_i0_mw": 53.7,
"guinier_i0_mw_error": 0.5,
"porod_mw": 123.0,
"porod_mw_error": null,
"pddf_i0": 53.6,
"pddf_i0_error": 0.2,
"guinier_i0": 53.6,
"guinier_i0_error": 0.12,
"pddf_rg": 3.58,
"pddf_rg_error": 0.01,
"guinier_rg": 3.57,
"guinier_rg_error": 0.03,
"pddf_dmax": 13.5,
"pddf_dmax_error": 2.0,
"porod_volume": 210.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 52,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCW7_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCW7",
"status": "success",
"started_at": "2026-08-11T16:47:04.383716+00:00",
"finished_at": "2026-08-11T16:47:14.287494+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCW7/",
"path": "/data/saxsdb/sasbdb/entries/w7/sasdcw7/source/summary.json",
"size": 7636,
"sha256": "0b2eef09b1f339e803434de3f2690cc8519084c0f846a2b20b07ade07bbafcb0"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCW7.dat",
"path": "/data/saxsdb/sasbdb/entries/w7/sasdcw7/source/SASDCW7.dat",
"size": 46142,
"sha256": "616352c9dacfe818f1af600af03618535a69d702475ffcf73ea947ceaa748716",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCW7.out",
"path": "/data/saxsdb/sasbdb/entries/w7/sasdcw7/source/SASDCW7.out",
"size": 45816,
"sha256": "75d1d3a88c8d3add5b3b248516a1ea63eba8f5d0cb3daa2836b7a555415d3f8a",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCW7.sascif",
"path": "/data/saxsdb/sasbdb/entries/w7/sasdcw7/source/SASDCW7.sascif",
"size": 532067,
"sha256": "036db56196dfddac929af88237ca2a98abedd6a6a4b9a5dd179b335647449cd0",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCW7.zip",
"path": "/data/saxsdb/sasbdb/entries/w7/sasdcw7/source/SASDCW7.zip",
"size": 115013,
"sha256": "b4d1a50a9e4459afa4689997a2e32e36fd68a0fa12a6b2e245e985384db78e72",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
