The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCX6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Saposin Lipid Nanoparticles: A Highly Versatile and Modular Tool for Membrane Protein Research.",
"publication": {
"title": "Saposin Lipid Nanoparticles: A Highly Versatile and Modular Tool for Membrane Protein Research.",
"author_list": "Flayhan A, Mertens HDT, Ural-Blimke Y, Martinez Molledo M, Svergun DI, Löw C",
"journal": "Structure",
"doi": "10.1016/j.str.2018.01.007",
"pmid": "29413323",
"published_date": "2018 Feb 6"
},
"status": "released",
"submitted_date": "2017-08-09",
"released_date": "2018-02-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCX6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCX6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCX6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCX6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "saposin-a",
"short_name": "sapA",
"sequence": "SM\r\nSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES",
"organism": "Homo sapiens",
"uniprot_code": "P07602",
"uniprot_range_first": 60,
"uniprot_range_last": 140,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKS\nLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDI\nIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLY\nPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADI\nCKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVE\nPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEV\nVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLD\nRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIG\nACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN",
"mw": 9.084,
"total_mw": 9.084,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "1-palmitoyl-2-oleoyl-sn-glycero-3-phospho-L-serine",
"short_name": "POPS",
"sequence": null,
"organism": "synthetic construct",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "other",
"uniprot_sequence": null,
"mw": 0.78,
"total_mw": 47.0,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Mechanosensitive channel T2",
"short_name": "T2",
"sequence": "MDRAKGKSIAVYVGSMIVLIIVLLALLYVLSLFHIVPIKFSRILYAVVIGLVIYAIV\r\nRIVTKYVERFISLHSEFKHLKYIVFIISLLGYFIISLAVLAALGIDVSSVILGSAFL\r\nSAIIGLAAQSVLANVFGGLFLSIVRPFKLGDHIVVNTWQFPVSFPSYPPKYFSRDFI\r\nEGSIYRGIVSDISINYTSIALESGDVVKIPNNIMIQAAITLRHGSVTVQARYEVPKY\r\nINFNDIYNKIVDEVGTLPGARNIGVMIDETTVNTYIILVRGDFQGEDADLVRSQILQ\r\nKVIGIVEPLKKQ",
"organism": "Thermoplasma volcanium",
"uniprot_code": "Q97AH5",
"uniprot_range_first": 1,
"uniprot_range_last": 197,
"oligomerization": "heptamer",
"molecular_type": "protein",
"uniprot_sequence": "MDRAKGKSIAVYVGSMIVLIIVLLALLYVLSLFHIVPIKFSRILYAVVIGLVIYAIVRIV\nTKYVERFISLHSEFKHLKYIVFIISLLGYFIISLAVLAALGIDVSSVILGSAFLSAIIGL\nAAQSVLANVFGGLFLSIVRPFKLGDHIVVNTWQFPVSFPSYPPKYFSRDFIEGSIYRGIV\nSDISINYTSIALESGDVVKIPNNIMIQAAITLRHGSVTVQARYEVPKYINFNDIYNKIVD\nEVGTLPGARNIGVMIDETTVNTYIILVRGDFQGEDADLVRSQILQKVIGIVEPLKKQ",
"mw": 32.887,
"total_mw": 230.209,
"number_molecules": 7,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "PBS",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": 7.0,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "T2 SapNP (SapA:POPS) (SEC-SAXS)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-05-04",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 1.0,
"number_of_frames": 3600,
"wavelength": 0.124,
"sample_detector_distance": 3.1,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.061,
"s_max": 5.035,
"total_exposure_time": 3600.0,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCX6_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.9.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCX6_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 3.8,
"log": null,
"symmetry": "P7",
"comment": "",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCX6_fit1_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.7,
"p_value": 0.007816,
"fit_residual_plot": "SASDCX6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCX6_fit1.fir",
"fit_log": null,
"software_version": "2.9.0",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "2.9.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 323.0,
"experimental_mw_error": 30.0,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 429.0,
"porod_mw_error": 40.0,
"pddf_i0": 2572.0,
"pddf_i0_error": 5.0,
"guinier_i0": 2564.0,
"guinier_i0_error": 5.0,
"pddf_rg": 5.4,
"pddf_rg_error": 0.2,
"guinier_rg": 5.4,
"guinier_rg_error": 0.2,
"pddf_dmax": 18.0,
"pddf_dmax_error": 0.5,
"porod_volume": 686.0,
"porod_volume_error": 70.0,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 15,
"guinier_point_last": 81,
"pddf_point_first": 15,
"pddf_point_last": 1000,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCX6_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
