The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCY5",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/nm",
"project": {
"title": "Low pH-induced conformational change and dimerization of sortilin triggers endocytosed ligand release.",
"publication": {
"title": "Low pH-induced conformational change and dimerization of sortilin triggers endocytosed ligand release.",
"author_list": "Leloup N, Lössl P, Meijer DH, Brennich M, Heck AJR, Thies-Weesie DME, Janssen BJC",
"journal": "Nat Commun",
"doi": "10.1038/s41467-017-01485-5",
"pmid": "29167428",
"published_date": "2017 Nov 22"
},
"status": "released",
"submitted_date": "2017-07-08",
"released_date": "2017-12-01"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCY5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCY5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCY5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCY5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Sortilin, also: Neurotensin-receptor 3",
"short_name": "Sort1, also: NTR3",
"sequence": "GSGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKVILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSAAAHHHHHH",
"organism": "Mus musculus",
"uniprot_code": "Q6PHU5",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRA\nAAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTG\nVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKV\nILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVS\nKNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVK\nIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVF\nMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSED\nNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEP\nNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNR\nPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTV\nDFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQ\nPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDK\nCQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYV\nCGGRFLVHRYSVLQQHAEADGVEALDSTSHAKSGYHDDSDEDLLE",
"mw": 76.585,
"total_mw": 153.17,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM MES pH 5.5, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 5.5,
"deuteration": null
},
"purity_method": null,
"name": "Dimeric Sortilin at pH 5.5",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL",
"address": "Grenoble, France",
"full_name": "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation",
"webpage": "https://www.embl.fr/"
}
],
"contributor_name": "Martha",
"contributor_surname": "Brennich",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-04-17",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 2600,
"wavelength": 0.099,
"sample_detector_distance": 2.87,
"concentration_min": 0.0,
"concentration_max": 0.62,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.127,
"s_max": 2.503,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCY5_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCY5_fit1_model1.pdb",
"model_mw": 151.4,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCY5_fit1_fit_img.png",
"software": "CORAL",
"chi_square_value": 0.73,
"p_value": 0.6273,
"fit_residual_plot": "SASDCY5_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCY5_fit1.fit",
"fit_log": null,
"software_version": "",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCY5_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCY5_fit2_model1.pdb",
"model_mw": 155.0,
"bead_radius": 2.3,
"log": "https://www.sasbdb.org/media/log_files/untitled_2314_14.log",
"symmetry": "",
"comment": "",
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCY5_fit2_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 0.7,
"p_value": 0.1782,
"fit_residual_plot": "SASDCY5_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCY5_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/untitled_2314_14.log",
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of dimeric sortilin at pH 5.5 in 25 mM MES pH 5.5, 150 mM NaCl, pH 5, were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Size-exclusion chromatography SAXS (SEC-SAXS) was performed at 20°C where 2600 successive 1 second frames were collected through the elution profile. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of an appropriate solvent-blank was subtracted from the SAXS data measured from the sample component elution peaks.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 198.0,
"experimental_mw_error": null,
"guinier_i0_mw": 168.0,
"guinier_i0_mw_error": 17.0,
"porod_mw": 198.0,
"porod_mw_error": null,
"pddf_i0": 52.9,
"pddf_i0_error": 0.08,
"guinier_i0": 53.19,
"guinier_i0_error": 0.08,
"pddf_rg": 3.82,
"pddf_rg_error": 0.07,
"guinier_rg": 3.89,
"guinier_rg_error": 0.01,
"pddf_dmax": 11.0,
"pddf_dmax_error": null,
"porod_volume": 336.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 45,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCY5_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCY5",
"status": "success",
"started_at": "2026-08-11T14:58:55.003749+00:00",
"finished_at": "2026-08-11T14:59:04.635782+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCY5/",
"path": "/data/saxsdb/sasbdb/entries/y5/sasdcy5/source/summary.json",
"size": 9619,
"sha256": "d5a630d97b84a6adf5cc027e1b9663afec6d2e5fad9c232829cb8141d67e5802"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCY5.dat",
"path": "/data/saxsdb/sasbdb/entries/y5/sasdcy5/source/SASDCY5.dat",
"size": 23366,
"sha256": "188cc6c35760f89018a789f68817beb9132785c2ec6b4ecec344e89627b78544",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCY5.out",
"path": "/data/saxsdb/sasbdb/entries/y5/sasdcy5/source/SASDCY5.out",
"size": 42180,
"sha256": "8c9a216b109bb8a2f02a4c4e4eed3c54c69bca3617a4d8a5de49f429ab5f0312",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCY5.sascif",
"path": "/data/saxsdb/sasbdb/entries/y5/sasdcy5/source/SASDCY5.sascif",
"size": 1585841,
"sha256": "4aff8aad2ba62dabc461073c210df527cdf6fb7e7d719903e8870d26a43394df",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCY5.zip",
"path": "/data/saxsdb/sasbdb/entries/y5/sasdcy5/source/SASDCY5.zip",
"size": 234837,
"sha256": "907b2c190b8ecc055826ac7bd1b8bb6b2c4b449bacc8663d64a5aac64537f23e",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
