The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCY9",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"publication": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"author_list": "Launay H, Barré P, Puppo C, Zhang Y, Maneville S, Gontero B, Receveur-Bréchot V",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2018.02.020",
"pmid": "29501381",
"published_date": "2018 Apr 13"
},
"status": "released",
"submitted_date": "2017-12-04",
"released_date": "2018-03-11"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCY9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCY9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCY9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCY9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCY9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Calvin cycle protein CP12, chloroplastic",
"short_name": "CP12",
"sequence": "HHHHHHHHHHSSGHIEGRHMSGQPAVDLNKKVQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFCKDAPDADECRVYED",
"organism": "Chlamydomonas reinhardtii",
"uniprot_code": "A6Q0K5",
"uniprot_range_first": 28,
"uniprot_range_last": 107,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MMLTKSVVISRPAVRPVSTRRAVVVRASGQPAVDLNKKVQDAVKEAEDACAKGTSADCAV\nAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFCKDAPDADECRVYED",
"mw": 10.934,
"total_mw": 10.934,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM phosphate buffer, 50 mM NaCl, 20 mM oxidized DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "Oxidised chloroplastic calvin cycle protein CP12 from C. reinhardtii",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marseille, France",
"full_name": "Aix Marseille Univ, CNRS, BIP UMR7281",
"webpage": "http://bip.cnrs-mrs.fr"
}
],
"contributor_name": "Veronique",
"contributor_surname": "Receveur-Brechot",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-11-03",
"storage_temperature": 15.0,
"cell_temperature": 20.0,
"exposure_time": 1.5,
"number_of_frames": 250,
"wavelength": 0.1033,
"sample_detector_distance": 1.79,
"concentration_min": 0.0,
"concentration_max": 0.54,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.181,
"s_max": 4.67,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCY9_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCY9_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/Ox-Gf.log",
"symmetry": null,
"comment": null,
"user": 264
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCY9_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 2.84,
"p_value": 2.2e-05,
"fit_residual_plot": "SASDCY9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCY9_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Ox-Gf.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCY9_fit2_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCY9_fit2_model1.pdb",
"model_mw": 7.019,
"bead_radius": 2.0,
"log": "https://www.sasbdb.org/media/log_files/damsel_rr7jm5c.log",
"symmetry": "P1",
"comment": null,
"user": 264
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCY9_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 2.367,
"p_value": 0.79356,
"fit_residual_plot": "SASDCY9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCY9_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Ox-Fa_13.log",
"software_version": null,
"description": null
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCY9_fit3_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.502,
"p_value": 0.176059,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCY9_fit3.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_VR5hfTN.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.5a",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of oxidised chloroplastic calvin cycle protein CP12i in 50 mM phosphate buffer, 50 mM NaCl, 20 mM oxidized DTT, pH 6.5, were collected on the SWING beam line at the SOLEIL storage ring (Saint-Aubin, France) using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 0.54 mg/ml was measured at 20°C. 250 successive 1.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the data were scaled for protein concentration.",
"tags": [
"idp"
],
"intensity_unit": "1/cm",
"experimental_mw": 12.65,
"experimental_mw_error": null,
"guinier_i0_mw": 12.65,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.003974,
"pddf_i0_error": 1.081e-05,
"guinier_i0": 0.0039,
"guinier_i0_error": 5e-05,
"pddf_rg": 2.46,
"pddf_rg_error": 0.01,
"guinier_rg": 2.3,
"guinier_rg_error": 0.01,
"pddf_dmax": 10.0,
"pddf_dmax_error": 0.2,
"porod_volume": 22.48,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 43,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCY9_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:28:14.712422+02:00",
"bragg_peak": []
}
