The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCZ9",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"publication": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"author_list": "Launay H, Barré P, Puppo C, Zhang Y, Maneville S, Gontero B, Receveur-Bréchot V",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2018.02.020",
"pmid": "29501381",
"published_date": "2018 Apr 13"
},
"status": "released",
"submitted_date": "2017-12-04",
"released_date": "2018-03-11"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCZ9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCZ9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCZ9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCZ9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCZ9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCZ9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCZ9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Glyceraldehyde-3-phosphate dehydrogenase",
"short_name": "GAPDH",
"sequence": "EKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKWVA",
"organism": "Chlamydomonas reinhardtii",
"uniprot_code": "A8HP84",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MAAMMQKSAFTGSAVSSKSGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQ\nNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQ\nLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKH\nEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA\nLNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFR\nEAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR\nVVDLAEVTAKKWVA",
"mw": 36.881,
"total_mw": 147.524,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "30 mM Tris, 4 mM EDTA, 100 µM NAD, 5 mM free cysteine",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.9,
"deuteration": null
},
"purity_method": null,
"name": "Glyceraldehyde-3-phosphate dehydrogenase from C. reinhardtii",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marseille, France",
"full_name": "Aix Marseille Univ, CNRS, BIP UMR7281",
"webpage": "http://bip.cnrs-mrs.fr"
}
],
"contributor_name": "Veronique",
"contributor_surname": "Receveur-Brechot",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2011-02-07",
"storage_temperature": 15.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 250,
"wavelength": 0.1033,
"sample_detector_distance": 1.817,
"concentration_min": null,
"concentration_max": 23.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.093,
"s_max": 3.842,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCZ9_fit1_model1_img.png",
"software": "MODELLER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCZ9_fit1_model1.pdb",
"model_mw": 149.7,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 264
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCZ9_fit1_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 8.543929,
"p_value": 0.0,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCZ9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Mod3K2B01.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCZ9_fit2_model1_img.png",
"software": "MODELLER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCZ9_fit2_model1.pdb",
"model_mw": 149.7,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 264
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCZ9_fit2_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 8.415801,
"p_value": 0.0,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCZ9_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Mod1NBO01.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of glyceraldehyde-3-phosphate dehydrogenase in 30 mM Tris, 4 mM EDTA, 100 µM NAD, 5 mM free cysteine, pH 7.9, were collected on the SWING beam line at the SOLEIL storage ring (Saint-Aubin, France) using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.1033 nm (I(s) vs s where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 23.00 mg/ml was measured at 20°C. 250 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 148.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.0002599,
"pddf_i0_error": 1e-08,
"guinier_i0": 0.000257,
"guinier_i0_error": 9e-07,
"pddf_rg": 3.24,
"pddf_rg_error": 0.001,
"guinier_rg": 3.18,
"guinier_rg_error": 0.02,
"pddf_dmax": 8.95,
"pddf_dmax_error": 0.05,
"porod_volume": 206.43,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 35,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCZ9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
