The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD32",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Recombinant production of A1S_0222 from Acinetobacter baumannii ATCC 17978 and confirmation of its DNA-(adenine N6)-methyltransferase activity.",
"publication": {
"title": "Recombinant production of A1S_0222 from Acinetobacter baumannii ATCC 17978 and confirmation of its DNA-(adenine N6)-methyltransferase activity.",
"author_list": "Blaschke U, Suwono B, Zafari S, Ebersberger I, Skiebe E, Jeffries CM, Svergun DI, Wilharm G",
"journal": "Protein Expr Purif",
"doi": "10.1016/j.pep.2018.06.009",
"pmid": "29908915",
"published_date": "2018 Nov"
},
"status": "released",
"submitted_date": null,
"released_date": "2018-06-22"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD32.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD32.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD32_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD32_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD32_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD32_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD32.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DNA-(adenine N6)-methyltransferase",
"short_name": "A1S_0222",
"sequence": "MNSEPSVYHKRRHAARTTDEYLFHQLVPYLGNKRRLLHLILEALEITGTLNSKKKNPPIFADFFAGSGVV\r\nSRLARQNGYRVIANDWEPYSHALNHAILACVDAPAFKELGGYQKAIDYLNRLPEVKGWVTHNLCPRNDDV\r\nYDPSRDRLFFKRRNGMRIDAIRQQIATWQAQGAINDVEMSALLAPLLYSASFVSNTSGVFKSFHQGWGGR\r\nTQTALERIESLLWLTPSRFCEIGDRKRPAAEMWCVDAQHLANQMSGFEVDVAYLDPPYNQHAYSSNYHVL\r\nNALTLWDQVDLPPPDTKGYKSGIDRAWRKERPSPYNSSKHAKDAYEKLLSTINARYILTSYSTDGNIEPK\r\nDLLMANLERGKVTLLTQDVPRYRVSKQRQSERARVLEFIVITDTHAKPGPPLRQLLGQLYHFAELGGVDT\r\nSGNSTQLALW",
"organism": "Acinetobacter baumannii",
"uniprot_code": null,
"uniprot_range_first": 2,
"uniprot_range_last": 430,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 48.902,
"total_mw": 48.902,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "150mM NaCl, 10mM Tris, 1mM DTT, 5% v/v glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "DNA-(adenine N6)-methyltransferase from Acinetobacter baumannii ATCC 17978",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Cy M",
"contributor_surname": "Jeffries",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-09-30",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 2.4,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.013,
"s_max": 3.792,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD32_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD32_fit1_model1.pdb",
"model_mw": 60.92,
"bead_radius": 2.75,
"log": null,
"symmetry": "P1",
"comment": null,
"user": 9
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD32_fit1_model2_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD32_fit1_model2.pdb",
"model_mw": 59.096,
"bead_radius": 2.75,
"log": "https://www.sasbdb.org/media/log_files/damsel_FvNeMQj.log",
"symmetry": "P1",
"comment": null,
"user": 9
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD32_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.062,
"p_value": 0.132008,
"fit_residual_plot": "SASDD32_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD32_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/refine_NhMm40p.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The individual DAMMIN models used to generate that averaged spatial representation of the protein (DAMFILT model) are included in the full entry zip archive as well as the refinement of the averaged structure using DAMSTART.",
"experiment_description": "Synchrotron SAXS data from solutions of DNA-(adenine N6)-methyltransferase in 150mM NaCl, 10mM Tris, 1mM DTT, 5% v/v glycerol, pH 7.4 were collected at the P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 2.40 mg/ml was measured at 10°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the data were scaled to protein concentration.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 52.0,
"experimental_mw_error": null,
"guinier_i0_mw": 52.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 3773.0,
"pddf_i0_error": 8.0,
"guinier_i0": 3765.76,
"guinier_i0_error": 6.6,
"pddf_rg": 2.97,
"pddf_rg_error": 0.01,
"guinier_rg": 2.91,
"guinier_rg_error": 0.31,
"pddf_dmax": 11.11,
"pddf_dmax_error": null,
"porod_volume": 96.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 30,
"guinier_point_last": 208,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD32_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDD32",
"status": "success",
"started_at": "2026-08-11T13:29:23.629285+00:00",
"finished_at": "2026-08-11T13:29:33.397953+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD32/",
"path": "/data/saxsdb/sasbdb/entries/32/sasdd32/source/summary.json",
"size": 8512,
"sha256": "d61db4d6129b2bc4a3ab623cb939168f92def63c09c01dfdddd0f8ea60695677"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD32.dat",
"path": "/data/saxsdb/sasbdb/entries/32/sasdd32/source/SASDD32.dat",
"size": 85041,
"sha256": "5b8b71111bf2b5f469694a405ea6c6eeed4bcc255244ac4c074aa1b32ffb7e3f",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD32.out",
"path": "/data/saxsdb/sasbdb/entries/32/sasdd32/source/SASDD32.out",
"size": 127627,
"sha256": "fbace90295a1eedae687047c4707ecb7271e1c933bdca8548b793231373308f2",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD32.sascif",
"path": "/data/saxsdb/sasbdb/entries/32/sasdd32/source/SASDD32.sascif",
"size": 446079,
"sha256": "2c4da4b41354f61b745a6d8fca0c7c73917a830fe8c521a7e09e60df47a147c8",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD32.zip",
"path": "/data/saxsdb/sasbdb/entries/32/sasdd32/source/SASDD32.zip",
"size": 1102559,
"sha256": "838c1ec4de04b8a626e01d953f5de3e88c80de8b9aef8866956ed6a5bd0a44b1",
"role": "full_entry_zip",
"zip_member_count": 7,
"zip_validation": "central_directory_readable"
}
]
}
