The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD47",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "FusC, a member of the M16 protease family acquired by bacteria for iron piracy against plants.",
"publication": {
"title": "FusC, a member of the M16 protease family acquired by bacteria for iron piracy against plants.",
"author_list": "Grinter R, Hay ID, Song J, Wang J, Teng D, Dhanesakaran V, Wilksch JJ, Davies MR, Littler D, Beckham SA, Henderson IR, Strugnell RA, Dougan G, Lithgow T",
"journal": "PLoS Biol",
"doi": "10.1371/journal.pbio.2006026",
"pmid": "30071011",
"published_date": "2018 Aug"
},
"status": "released",
"submitted_date": "2018-05-19",
"released_date": "2018-06-13"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD47.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD47.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD47_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD47_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD47_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD47_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD47.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Ferredoxin protease E83A mutant",
"short_name": "FusC E83A",
"sequence": "EEIKSPLPVFKEGTLANGFRYTLVQLEGPKTRVDIRLIVDVGSIDEKDNESGVAH\r\nMVAHMVFRASDAFPQGVSTELHKQGWGRGQSYNAVTNYERTMYMMSPPKGNLDLGATLQALSQMTGHAKLLQSDLDDERK\r\nIILEEWRGKLGVAERMNQQRVQAIRHDSRYPSRPVIGTEESINDTPASVLQDFYQRWYHPSNMRLMIIGDITPADAEREI\r\nQRYFAALPNVAVPTRDYYEPLLKPQLKVARLQDSQSGSSQVSFVYRFNDKDAFGQSEYRHRLLTQITMSAVTRQVRRQKA\r\nELPQDASSLVVRKSDIGKTTAALGFFANVMPGGHDAAISAVLKEIERFKRYPLNEQDITEITSDIREVAQRMSVTPETRE\r\nFADWVQQLTIVWQQDRPYVGSQQRGKDALEALDTIKGEDVNRHWQRWLASPDTLAQFSVPGATPFTLPKPDAISKLQKQW\r\nALATLAPLRLEEKKIIPELPSVTQSGKRTAVKTFAAQKVEQWQLSNGDRVVWLRAPEAGKKVYLTATSQAGFMATAMNPW\r\nQAQLASQLVNQSGPATWSGESLSNWKKEKTLSLSIDQEADQLTLSGTAPTEQLASLFGLYRELNVAPGIDPDVMKESMMS\r\nLARQKANDDQSVGGKRASEMTKLRFGEPAWQQPEIAELKKISAPALLSQWHKAASAPVTYYLIADMPATQLLPQVERYLA\r\nTIPRQPASEVKQHLALSGKREATSAINVEPRADILTWSFTPHAWTPQAAVQVSIARNIASKYLKTSLRDDALGIYRMRVD\r\nSELEDKKQRIETEVSFTSAPERAQELWTLAEQAFSELPTKITQQDVDEQKAQFIRAEKGRQGDLTTIQRRLILSYRHYND\r\nPRYLSNASKLADSITLESVRAMSAKLYNPDNRVLYITLPQEVKE",
"organism": "Pectobacterium atrosepticum SCRI1043",
"uniprot_code": "Q6D8U3",
"uniprot_range_first": 26,
"uniprot_range_last": 924,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MNWKKCCWLSLTAVGLLAGSVVSQAEEIKSPLPVFKEGTLANGFRYTLVQLEGPKTRVDI\nRLIVDVGSIDEKDNESGVAHMVEHMVFRASDAFPQGVSTELHKQGWGRGQSYNAVTNYER\nTMYMMSPPKGNLDLGATLQALSQMTGHAKLLQSDLDDERKIILEEWRGKLGVAERMNQQR\nVQAIRHDSRYPSRPVIGTEESINDTPASVLQDFYQRWYHPSNMRLMIIGDITPADAEREI\nQRYFAALPNVAVPTRDYYEPLLKPQLKVARLQDSQSGSSQVSFVYRFNDKDAFGQSEYRH\nRLLTQITMSAVTRQVRRQKAELPQDASSLVVRKSDIGKTTAALGFFANVMPGGHDAAISA\nVLKEIERFKRYPLNEQDITEITSDIREVAQRMSVTPETREFADWVQQLTIVWQQDRPYVG\nSQQRGKDALEALDTIKGEDVNRHWQRWLASPDTLAQFSVPGATPFTLPKPDAISKLQKQW\nALATLAPLRLEEKKIIPELPSVTQSGKRTAVKTFAAQKVEQWQLSNGDRVVWLRAPEAGK\nKVYLTATSQAGFMATAMNPWQAQLASQLVNQSGPATWSGESLSNWKKEKTLSLSIDQEAD\nQLTLSGTAPTEQLASLFGLYRELNVAPGIDPDVMKESMMSLARQKANDDQSVGGKRASEM\nTKLRFGEPAWQQPEIAELKKISAPALLSQWHKAASAPVTYYLIADMPATQLLPQVERYLA\nTIPRQPASEVKQHLALSGKREATSAINVEPRADILTWSFTPHAWTPQAAVQVSIARNIAS\nKYLKTSLRDDALGIYRMRVDSELEDKKQRIETEVSFTSAPERAQELWTLAEQAFSELPTK\nITQQDVDEQKAQFIRAEKGRQGDLTTIQRRLILSYRHYNDPRYLSNASKLADSITLESVR\nAMSAKLYNPDNRVLYITLPQEVKE",
"mw": 101.195,
"total_mw": 101.195,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Arabidopsis ferredoxin 2",
"short_name": "Ara_Fer2",
"sequence": "ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIMLEHHHHHH",
"organism": "Arabidopsis thaliana",
"uniprot_code": "P16972",
"uniprot_range_first": 53,
"uniprot_range_last": 145,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI\nTPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ\nIGEGFVLTCAAYPTSDVTIETHKEEDIV",
"mw": 11.33,
"total_mw": 11.33,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "The ferredoxin protease, FusC, E83A mutant + 100 µM Arabidopsis ferredoxin",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Melbourne, Australia",
"full_name": "Monash University",
"webpage": "http://www.monash.edu/"
}
],
"contributor_name": "Grinter",
"contributor_surname": "Grinter",
"orcid": "https://orcid.org/0000-0002-8195-5348"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-10-26",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.103,
"sample_detector_distance": 1.28,
"concentration_min": null,
"concentration_max": 3.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.114,
"s_max": 3.038,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The FusC E83A mutant (30 µM) in the presence of 100 µM Arabidopsis ferredoxin. The background subtraction included 100 µM Arabidopsis ferredoxin in buffer.",
"experiment_description": "Synchrotron SAXS data from solutions of ferredoxin protease, FusC, E83A mutant + 100 µM Arabidopsis ferredoxin in 20 mM Tris, 150 mM NaCl, pH 7.8 were collected on the SAXS/WAXS beam line at the Australian Synchrotron storage ring (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 1.3 m and at a wavelength of λ = 0.103 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 100.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 103.9,
"porod_mw_error": null,
"pddf_i0": 0.2708,
"pddf_i0_error": null,
"guinier_i0": 0.28,
"guinier_i0_error": 0.00032,
"pddf_rg": 3.81,
"pddf_rg_error": null,
"guinier_rg": 3.72,
"guinier_rg_error": 0.064,
"pddf_dmax": 13.69,
"pddf_dmax_error": null,
"porod_volume": 176.7,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 12,
"guinier_point_last": 33,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD47_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDD47",
"status": "success",
"started_at": "2026-08-11T15:21:38.447682+00:00",
"finished_at": "2026-08-11T15:21:46.050244+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD47/",
"path": "/data/saxsdb/sasbdb/entries/47/sasdd47/source/summary.json",
"size": 8959,
"sha256": "6afd1b45965ca8c86370238bef063455330ded9f264795e387bae199de82dfc3"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD47.dat",
"path": "/data/saxsdb/sasbdb/entries/47/sasdd47/source/SASDD47.dat",
"size": 18462,
"sha256": "50e31fdcbd2afdc63ac486545794a6a61b7cb8371e1de6470f4d60da3a9c35c8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD47.out",
"path": "/data/saxsdb/sasbdb/entries/47/sasdd47/source/SASDD47.out",
"size": 29986,
"sha256": "11415abd8344ad280cbea8e3dd08c432cbc68d59c0e6924a852eb8bf9ac02c68",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD47.sascif",
"path": "/data/saxsdb/sasbdb/entries/47/sasdd47/source/SASDD47.sascif",
"size": 47313,
"sha256": "8da5e97883dbb4c1adb50d793afd2d9d2fc72a81883acb6b480998bf09b7a4c3",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD47.zip",
"path": "/data/saxsdb/sasbdb/entries/47/sasdd47/source/SASDD47.zip",
"size": 13905,
"sha256": "8039a1933f3566234331bfe226d0bbbc882385740e006fd9dc105a3ed5021bf1",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
