The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD73",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/A",
"project": {
"title": "Structural Insight into Catalysis by the Flavin-Dependent NADH Oxidase (Pden_5119) of Paracoccus denitrificans.",
"publication": {
"title": "Structural Insight into Catalysis by the Flavin-Dependent NADH Oxidase (Pden_5119) of Paracoccus denitrificans.",
"author_list": "Kryl M, Sedláček V, Kučera I",
"journal": "Int J Mol Sci",
"doi": "10.3390/ijms24043732",
"pmid": "36835143",
"published_date": "2023 Feb 13"
},
"status": "released",
"submitted_date": "2018-01-23",
"released_date": "2023-08-31"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD73.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD73.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD73_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD73_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD73_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD73_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD73.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "CEITEC",
"city": "Brno",
"country": "Czech Republic",
"beamline_name": "Rigaku BioSAXS-1000",
"beam_geometry": "",
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "NADPH-dependent FMN reductase",
"short_name": "Pden_5119",
"sequence": "MPGPRIVAFAGSWSRPSKTRSLVEEAARRAVARFGGSAHVFDIADLGPDFGSLRQPQDGP\r\nHTRHLDAFLAADALIVASPVYKGSYTGLFKHFIDLIEPVALVGKPVLLAATGGGDRHALV\r\nIEHQLRPVFGFFEAHTLATGLYVSASDFGPDGLASEAASTRLDRAVAQFAAHLSRHDAAP\r\nLLAVGLEHHHHHH",
"organism": "Paracoccus denitrificans",
"uniprot_code": "A1BCD5",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MPGPRIVAFAGSWSRPSKTRSLVEEAARRAVARFGGSAHVFDIADLGPDFGSLRQPQDGP\nHTRHLDAFLAADALIVASPVYKGSYTGLFKHFIDLIEPVALVGKPVLLAATGGGDRHALV\nIEHQLRPVFGFFEAHTLATGLYVSASDFGPDGLASEAASTRLDRAVAQFAAHLSRHDAAP\nLLAVG",
"mw": 20.596,
"total_mw": 41.192,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM sodium phosphate buffer, 300 mM NaCl, 500 mM imidazole",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Flavin reductase Pden_5119",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
"webpage": "https://www.ceitec.eu/"
}
],
"contributor_name": "Tomas",
"contributor_surname": "Klumpler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-02-22",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 600.0,
"number_of_frames": 30,
"wavelength": 0.154,
"sample_detector_distance": 0.48,
"concentration_min": 1.5,
"concentration_max": 7.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.152,
"s_max": 3.012,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD73_fit1_model2_img.png",
"software": "SwissModel",
"pdb_link": [
{
"pdb_code": "4c76",
"ext_code": "4c76",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "1.1.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD73_fit1_model2.pdb",
"model_mw": 36.71,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/4c76-homology_model_dimer00.log",
"symmetry": "P2",
"comment": null,
"user": 195
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD73_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.032,
"p_value": 0.178897,
"fit_residual_plot": "SASDD73_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD73_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/4c76-homology_model_dimer00.log",
"software_version": "2.8.3",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD73_fit2_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD73_fit2_model1.pdb",
"model_mw": 29.506,
"bead_radius": 1.5,
"log": "https://www.sasbdb.org/media/log_files/dammin-slow-P2.log",
"symmetry": "P2",
"comment": null,
"user": 195
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD73_fit2_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.366,
"p_value": 0.541867,
"fit_residual_plot": "SASDD73_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD73_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dammin-slow-P2.log",
"software_version": "5.3",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of flavin reductase Pden_5119 in 50 mM sodium phosphate buffer, 300 mM NaCl, 500 mM imidazole, pH 8, were collected on a Rigaku BioSAXS-1000 instrument at the Central European Institute of Technology, CEITEC, (Brno, Czech Republic) using a Pilatus 100K detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.154 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1.5 and 7.5 mg/ml were measured at 4°C. 30 successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 41.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 43.6,
"porod_mw_error": null,
"pddf_i0": 0.1389,
"pddf_i0_error": null,
"guinier_i0": 0.14,
"guinier_i0_error": 0.0015,
"pddf_rg": 2.3,
"pddf_rg_error": null,
"guinier_rg": 2.34,
"guinier_rg_error": 0.098,
"pddf_dmax": 6.27,
"pddf_dmax_error": null,
"porod_volume": 69.8,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 29,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD73_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-08-31T11:57:49.604042+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDD73",
"status": "success",
"started_at": "2026-08-11T13:53:50.211184+00:00",
"finished_at": "2026-08-11T13:53:59.773558+00:00",
"source_last_modified": "2023-08-31T11:57:49.604042+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD73/",
"path": "/data/saxsdb/sasbdb/entries/73/sasdd73/source/summary.json",
"size": 8997,
"sha256": "1f9e6aad7d9e111dcf8ea4ca5185c0db3fa29ddbaaf6e89984deb80832c818a2"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD73.dat",
"path": "/data/saxsdb/sasbdb/entries/73/sasdd73/source/SASDD73.dat",
"size": 9321,
"sha256": "456e3e344711bfa37efb86b367434a5f1fadd3eb27c9f5c7b5cfa9b7f1c179a8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD73.out",
"path": "/data/saxsdb/sasbdb/entries/73/sasdd73/source/SASDD73.out",
"size": 22572,
"sha256": "58d006e99d928029a0c86d47211c7270eb8f0e22e57554a8cb2f6b4d319c8543",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD73.sascif",
"path": "/data/saxsdb/sasbdb/entries/73/sasdd73/source/SASDD73.sascif",
"size": 622358,
"sha256": "b4e861e8f6267672aa97f7d47ba3ca50f195a0985bffce68a70fbfb81dcf2a89",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD73.zip",
"path": "/data/saxsdb/sasbdb/entries/73/sasdd73/source/SASDD73.zip",
"size": 135893,
"sha256": "1e7aea0210441a79c032e01698bcf7cc7e3db7e4c768809832928098f732e8e7",
"role": "full_entry_zip",
"zip_member_count": 8,
"zip_validation": "central_directory_readable"
}
]
}
