The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD83",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Identification of a novel tetrameric structure for human apolipoprotein-D.",
"publication": {
"title": "Identification of a novel tetrameric structure for human apolipoprotein-D.",
"author_list": "Kielkopf CS, Low JKK, Mok YF, Bhatia S, Palasovski T, Oakley AJ, Whitten AE, Garner B, Brown SHJ",
"journal": "J Struct Biol",
"doi": "10.1016/j.jsb.2018.05.012",
"pmid": "29885491",
"published_date": "2018 Sep"
},
"status": "released",
"submitted_date": "2018-01-24",
"released_date": "2018-01-31"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD83.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD83.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD83_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD83_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD83_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD83_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD83.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Apolipoprotein D",
"short_name": "ApoD",
"sequence": "QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQEL\r\nRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVD\r\nFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS",
"organism": "Homo sapiens",
"uniprot_code": "P05090",
"uniprot_range_first": 21,
"uniprot_range_last": 189,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR\nCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI\nLATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT\nDQVNCPKLS",
"mw": 19.303,
"total_mw": 77.212,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Na Phosphate, 150 mM NaCl, 3% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Apolipoprotein D (ApoD) tetramer",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "UOW",
"address": "Wollongong, Australia",
"full_name": "University of Wollongong (UOW)",
"webpage": "https://www.uow.edu.au"
}
],
"contributor_name": "Claudia",
"contributor_surname": "Kielkopf",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-11-11",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": 1.0,
"number_of_frames": null,
"wavelength": 0.10322,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.099,
"s_max": 3.593,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD83_fit1_model1_img.png",
"software": "SASREF CV",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD83_fit1_model1.pdb",
"model_mw": 95.61,
"bead_radius": 1.9,
"log": null,
"symmetry": "P222",
"comment": "The restraints used are 32 Ang between: a)K55-K55; b) K156-K156; c) K155-K156 and; d) K144-K156",
"user": 265
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD83_fit1_fit_img.png",
"software": "SASREF CV",
"chi_square_value": 1.28,
"p_value": 0.068535,
"fit_residual_plot": "SASDD83_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD83_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD83_fit2_model1_img.png",
"software": "SASREF CV",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD83_fit2_model1.pdb",
"model_mw": 95.61,
"bead_radius": 1.9,
"log": null,
"symmetry": "P222",
"comment": "The restraints used are 32 Ang between: a) K55-K55; b) K156-K156; c) K155-K156 and; d) K144-K156.",
"user": 265
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD83_fit2_fit_img.png",
"software": "SASREF CV",
"chi_square_value": 1.26,
"p_value": 0.068535,
"fit_residual_plot": "SASDD83_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD83_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Additional SEC-SAXS information: SEC-column: GE Healthcare Superdex S200 5/150; Loading concentration (measured using BCA assay): 7.5 mg/ml; Injection volume : 50 µl; Flow rate: 0.45 ml/min; Number of frames averaged over the elution peak: 15. The starting pdb model was the apo-form of apoD with modelled glycans (Oakley et al. 2012). The refined SASREF CV model incorporated contact restraints derived from crosslinking mass spectrometry (crosslinker BS3) that are included in the full entry zip archive (32 Ang between: a, K55-K55; b, K156-K156; c, K155-K156 and; d, K144-K156.)",
"experiment_description": "Synchrotron SAXS data from solutions of apolipoprotein D (ApoD) tetramer in 50 mM Na Phosphate, 150 mM NaCl, 3% glycerol, pH 7.4 were collected on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a wavelength of λ = 0.10322 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The SAXS data were collected using size-exclusion chromatography SAXS (SEC-SAXS).",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 99.0,
"experimental_mw_error": null,
"guinier_i0_mw": 96.9,
"guinier_i0_mw_error": null,
"porod_mw": 99.0,
"porod_mw_error": null,
"pddf_i0": 0.03692,
"pddf_i0_error": 5.933e-05,
"guinier_i0": 0.037,
"guinier_i0_error": 4.6e-05,
"pddf_rg": 3.37,
"pddf_rg_error": 0.007,
"guinier_rg": 3.363,
"guinier_rg_error": 0.02,
"pddf_dmax": 11.01,
"pddf_dmax_error": 0.01,
"porod_volume": 169.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 25,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD83_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-01-23T07:39:45.510730+01:00",
"bragg_peak": []
}
