Neurexin 1a L5L6

{
  "code": "SASDD95",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural Plasticity of Neurexin 1α: Implications for its Role as Synaptic Organizer.",
    "publication": {
      "title": "Structural Plasticity of Neurexin 1α: Implications for its Role as Synaptic Organizer.",
      "author_list": "Liu J, Misra A, Reddy MVVVS, White MA, Ren G, Rudenko G",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2018.08.026",
      "pmid": "30193986",
      "published_date": "2018 Oct 19"
    },
    "status": "released",
    "submitted_date": "2018-03-22",
    "released_date": "2018-09-10"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD95.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD95.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD95_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD95_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD95_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD95_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD95.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "Sealy Center For Structural Biology, UTMB-G",
      "city": "Galveston, TX",
      "country": "USA",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Neurexin 1a L5L6",
          "short_name": "L5L6",
          "sequence": "ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLH\r\nYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLK\r\nSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERG\r\nCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRP\r\nSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNA\r\nIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQG\r\nQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG\r\nEVPSASTSHHHHHH",
          "organism": null,
          "uniprot_code": "Q9ULB1",
          "uniprot_range_first": 904,
          "uniprot_range_last": 1307,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGTALLQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT\nRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR\nRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF\nKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQ\nAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNP\nIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNG\nKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSP\nSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLD\nPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDF\nFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTA\nPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMA\nEVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLS\nYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTV\nNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHT\nRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFR\nNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKG\nYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNL\nDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGC\nEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWP\nPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAI\nEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQG\nQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS\nIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTR\nAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRN\nYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV",
          "mw": 44.499,
          "total_mw": 44.499,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES pH 8, 150 mM NaCl, 0.5mM CaCl2",
        "concentration_unit": null,
        "comment": "N1a Buffer",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Neurexin 1a L5L6",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Texas, USA",
            "full_name": "University of Texas Medical Branch",
            "webpage": "http://www.bmb.utmb.edu/"
          }
        ],
        "contributor_name": "Mark",
        "contributor_surname": "White",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-09-06",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 10.0,
    "number_of_frames": 3,
    "wavelength": 0.15418,
    "sample_detector_distance": 0.4838,
    "concentration_min": 2.0,
    "concentration_max": 4.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.165,
    "s_max": 6.854,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD95_fit1_model1_img.png",
          "software": "CORAL",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "05",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDD95_fit1_model1.pdb",
          "model_mw": 44.84,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "P1",
          "comment": null,
          "user": 85
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD95_fit1_fixed_fit_img.png",
      "software": "CORAL",
      "chi_square_value": 1.3,
      "p_value": 0.000154,
      "fit_residual_plot": "SASDD95_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD95_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/cL5a6m.log",
      "software_version": "05",
      "description": null
    },
    {
      "models": [],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD95_fit2_fixed_fit_img.png",
      "software": "EOM/GAJOE",
      "chi_square_value": 4.801,
      "p_value": 0.0,
      "fit_residual_plot": "SASDD95_fit2_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD95_fit2.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_011_1.log",
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of Neurexin 1a L5L6 in 20 mM HEPES pH 8, 150 mM NaCl, 0.5mM CaCl2, pH 8 were collected on a Rigaku BioSAXS-1000 instrument at the Sealy Center For Structural Biology, UTMB-G (Galveston, TX, USA) using a Kratky-2D Rigaku BioSAXS-1000 detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.15418 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 2 and 4 mg/ml were measured at 10°C. Three successive 10 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 39.8,
  "experimental_mw_error": null,
  "guinier_i0_mw": 39.6,
  "guinier_i0_mw_error": 0.1,
  "porod_mw": 43.0,
  "porod_mw_error": null,
  "pddf_i0": 39110.0,
  "pddf_i0_error": 89.0,
  "guinier_i0": 39647.6,
  "guinier_i0_error": 48.5,
  "pddf_rg": 3.0,
  "pddf_rg_error": 0.01,
  "guinier_rg": 3.02,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 10.0,
  "pddf_dmax_error": 0.5,
  "porod_volume": 69.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 17,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDD95_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-08-18T17:28:22.895829+02:00",
  "bragg_peak": []
}

{
  "code": "SASDD95",
  "status": "success",
  "started_at": "2026-08-11T14:42:21.747905+00:00",
  "finished_at": "2026-08-11T14:42:30.368786+00:00",
  "source_last_modified": "2021-08-18T17:28:22.895829+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD95/",
      "path": "/data/saxsdb/sasbdb/entries/95/sasdd95/source/summary.json",
      "size": 9581,
      "sha256": "934469f52553470a4696eea3619f399af7427c4d8f31044e541428a414b7a0f5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDD95.dat",
      "path": "/data/saxsdb/sasbdb/entries/95/sasdd95/source/SASDD95.dat",
      "size": 21766,
      "sha256": "a73e25961a0525d471f5e311d69ad9144dff653839579bf4eb7c2388f336792f",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDD95.out",
      "path": "/data/saxsdb/sasbdb/entries/95/sasdd95/source/SASDD95.out",
      "size": 44615,
      "sha256": "ae593864f43ccf60183d7380598bf16d77a9fe9c69fcc2ac79d050905ec4acc3",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD95.sascif",
      "path": "/data/saxsdb/sasbdb/entries/95/sasdd95/source/SASDD95.sascif",
      "size": 423859,
      "sha256": "ad6abdceff7f076fedda53c299fa2d78d5607062c9cbca4ea469b9cf9091a298",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDD95.zip",
      "path": "/data/saxsdb/sasbdb/entries/95/sasdd95/source/SASDD95.zip",
      "size": 91757,
      "sha256": "955202df79ff6c0ddf38ace2945e244bb6b4689fcca55058da59c0768369185b",
      "role": "full_entry_zip",
      "zip_member_count": 8,
      "zip_validation": "central_directory_readable"
    }
  ]
}