Small glutamine-rich tetratricopeptide repeat-containing protein alpha (full length; SGTA_FL)

{
  "code": "SASDDB6",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural complexity of the co-chaperone SGTA: a conserved C-terminal region is implicated in dimerization and substrate quality control.",
    "publication": {
      "title": "Structural complexity of the co-chaperone SGTA: a conserved C-terminal region is implicated in dimerization and substrate quality control.",
      "author_list": "Martínez-Lumbreras S, Krysztofinska EM, Thapaliya A, Spilotros A, Matak-Vinkovic D, Salvadori E, Roboti P, Nyathi Y, Muench JH, Roessler MM, Svergun DI, High S, Isaacson RL",
      "journal": "BMC Biol",
      "doi": "10.1186/s12915-018-0542-3",
      "pmid": "29996828",
      "published_date": "2018 Jul 11"
    },
    "status": "released",
    "submitted_date": "2018-05-02",
    "released_date": "2018-06-11"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDB6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB6_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDB6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Small glutamine-rich tetratricopeptide repeat-containing protein alpha full length",
          "short_name": "SGTA_FL",
          "sequence": "GSMDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE\r\nIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL\r\nNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVA\r\nYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN\r\nPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR\r\nSRTPSASNDDQQE",
          "organism": "Homo sapiens",
          "uniprot_code": "O43765",
          "uniprot_range_first": 1,
          "uniprot_range_last": 313,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE\nIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL\nNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVA\nYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN\nPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR\nSRTPSASNDDQQE",
          "mw": 34.207,
          "total_mw": 68.414,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "10 mM potassium phosphate, 100 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Small glutamine-rich tetratricopeptide repeat-containing protein alpha (full length; SGTA_FL)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "London, UK",
            "full_name": "King's College London",
            "webpage": "https://www.kcl.ac.uk"
          }
        ],
        "contributor_name": "Rivka",
        "contributor_surname": "Isaacson",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-06-05",
    "storage_temperature": null,
    "cell_temperature": 25.0,
    "exposure_time": 0.045,
    "number_of_frames": 20,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": 0.6,
    "concentration_max": 8.8,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.051,
    "s_max": 4.801,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the small glutamine-rich tetratricopeptide repeat-containing protein alpha (full length; SGTA_FL) in 10 mM potassium phosphate, 100 mM NaCl, pH 6, were collected on the EMBL P12 beam line at the PETRA III storage ring (DESY, Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.6 and 8.8 mg/ml were measured at 25°C. 20 successive 0.045 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 65.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 16855.0,
  "guinier_i0_error": 62.0,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 4.2,
  "guinier_rg_error": 0.1,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 3,
  "guinier_point_last": 93,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDB6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDDB6",
  "status": "success",
  "started_at": "2026-08-11T15:05:30.653662+00:00",
  "finished_at": "2026-08-11T15:05:37.480062+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDB6/",
      "path": "/data/saxsdb/sasbdb/entries/b6/sasddb6/source/summary.json",
      "size": 6856,
      "sha256": "60caaca7d73a0dba1e1423ec6f8d908ddfe9682af768d07cb8bf97539681bbb9"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDB6.dat",
      "path": "/data/saxsdb/sasbdb/entries/b6/sasddb6/source/SASDDB6.dat",
      "size": 81294,
      "sha256": "c063efbb8375c660a704ffdde6b5cc63a6ee9fdb506b679f5602c2b1e5edff71",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/b6/sasddb6/source/SASDDB6.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDB6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/b6/sasddb6/source/SASDDB6.sascif",
      "size": 103299,
      "sha256": "23885e98a87d9a625796bb5a2e668ab97e47637764e550254d69d358076feea5",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDB6.zip",
      "path": "/data/saxsdb/sasbdb/entries/b6/sasddb6/source/SASDDB6.zip",
      "size": 24026,
      "sha256": "480dc314b044b4643732810a8748d786604a16f36a4bc5fda3ce24a30c76f21c",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}