Synthetic FRET biosensor Twitch 2B N532F Ca-bound

{
  "code": "SASDDB7",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Synthetic FRET biosensor Twitch 2B",
    "publication": null,
    "status": "released",
    "submitted_date": "2018-05-25",
    "released_date": "2021-12-20"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDB7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB7_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDB7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Synthetic FRET biosensor Twitch2B N532F",
          "short_name": "TW6",
          "sequence": "MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT\r\nTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIF\r\nFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAIHGN\r\nVYITADKQKNGIKANFGLNCNIEDGSVQLADHYQQNTPIGDGPVLLPDNH\r\nYLSTQSKLSKDPNEKRDHMVLLEFVTAARMQVADASEEELSECFRIFDFD\r\nGNGFIDREEFGDIIRLTGEQLTDEDVDEIFGDSDTDKNGRIDFDEFLKMV\r\nENVQPIYPELMGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPN\r\nEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVE\r\nLDGDVNGHKFSVRGEGEGDATNGKLTLKLICTTGKLPVPWPTLVTTLGYG\r\nLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGD\r\nTLVNRIELKGIDFKEDGNILGHKLEYNYNSHFVYITADKQKNGIKANFKI\r\nRHNIED",
          "organism": "synthetic construct",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": null,
          "mw": 62.432,
          "total_mw": 62.432,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM MOPS 100 mM NaCl 5 mM CaCl2",
        "concentration_unit": null,
        "comment": "Buffer A",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Synthetic FRET biosensor Twitch 2B N532F Ca-bound",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Germany",
            "full_name": "Max Planck Institute for Biophysical Chemistry",
            "webpage": "https://www.mpibpc.mpg.de"
          }
        ],
        "contributor_name": "Pablo",
        "contributor_surname": "Trigo Mourino",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-06-30",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 12,
    "wavelength": 0.0995,
    "sample_detector_distance": 2.867,
    "concentration_min": null,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.035,
    "s_max": 4.952,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the synthetic FRET biosensor, Twitch 2B N532F, bound to calcium, in 20 mM MOPS 100 mM NaCl 5 mM CaCl2, pH 7 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.0995 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 20°C. 12 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 56.05,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 37.44,
  "guinier_i0_error": null,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 2.76,
  "guinier_rg_error": null,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 13,
  "guinier_point_last": 62,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDB7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-12-20T11:10:57.905086+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDB7",
  "status": "success",
  "started_at": "2026-08-11T15:25:53.653330+00:00",
  "finished_at": "2026-08-11T15:26:00.256876+00:00",
  "source_last_modified": "2021-12-20T11:10:57.905086+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDB7/",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasddb7/source/summary.json",
      "size": 5923,
      "sha256": "837103e6bd504503b54e655341c8ee15f4ffec6317d33f33fcf81f1d4c90f5ae"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDB7.dat",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasddb7/source/SASDDB7.dat",
      "size": 57933,
      "sha256": "795912d6a5481fe6554c025169901cf42c8c33047a240736eebe64ae7742b1b1",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasddb7/source/SASDDB7.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDB7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasddb7/source/SASDDB7.sascif",
      "size": 61493,
      "sha256": "ef03cb9f66e4f9d037858a701cfd47c290f165e68c7ca3b21fbd141fdc695b7b",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDB7.zip",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasddb7/source/SASDDB7.zip",
      "size": 17873,
      "sha256": "485df0839d4f1d7e48eee90f2dfe24d1d74641442e30aa5326a1a8ae5fde5589",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}