Phosphorylated Microtubule associated protein MAP2c (isoform 3); 1.7 mg/ml

{
  "code": "SASDDC2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Functionally specific binding regions of microtubule-associated protein 2c exhibit distinct conformations and dynamics.",
    "publication": {
      "title": "Functionally specific binding regions of microtubule-associated protein 2c exhibit distinct conformations and dynamics.",
      "author_list": "Melková K, Zapletal V, Jansen S, Nomilner E, Zachrdla M, Hritz J, Nováček J, Zweckstetter M, Jensen MR, Blackledge M, Žídek L",
      "journal": "J Biol Chem",
      "doi": "10.1074/jbc.RA118.001769",
      "pmid": "29925592",
      "published_date": "2018 Aug 24"
    },
    "status": "released",
    "submitted_date": "2017-12-21",
    "released_date": "2018-06-19"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDC2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC2_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDC2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Microtubule-associated protein 2, isoform 3",
          "short_name": "MAP2c",
          "sequence": "MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGSGEGLSRSANGFPYREEEEGAFGEHGSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQPAALPLAAEETVNLPPSPPPSPASEQTAALEEATSGESAQAPSAFKQAKDKVTDGITKSPEKRSSLPRPSSILPPRRGVSGDREENSFSLNSSISSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPGTPKSGILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPSRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL",
          "organism": "Rattus norvegicus",
          "uniprot_code": "P15146",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGSGEGLSRSANGFPYREEEEGAFGE\nHGSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQP\nAALPLAAEETVNLPPSPPPSPASEQTAALEEDLLTASKMEFPEQQKLPSSFAEPLDKEET\nEFKMQSKPGEDFEHAALVPQPDTSKTPQDKKDPQDMEGEKSPASPFAQTFGTNLEDIKQI\nTEPSITVPSIGLSAEPLAPKDQKDWFIEMPVESKKDEWGLAAPISPGPLTPMREKDVLED\nIPRWEGKQFDSPMPSPFHGGSFTLPLDTVKDERVTEGSQPFAPVFFQSDDKMSLQDTSGS\nATSKESSKDEEPQKDKADKVADVPVSEATTVLGDVHSPAVEGFVGENISGEEKGTTDQEK\nKETSTPSVQEPTLTETEPQTKLEETSKVSIEETVAKEEESLKLKDDKAGVIQTSTEQSFS\nKEDQKGQEQTIEALKQDSFPISLEQAVTDAAMATKTLEKVTSEPEAVSEKREIQGLFEED\nIADKSKLEGAGSATVAEVEMPFYEDKSGMSKYFETSALKEDVTRSTGLGSDYYELSDSRG\nNAQESLDTVSPKNQQDEKELLAKASQPSPPAHEAGYSTLAQSYTSDHPSELPEEPSSPQE\nRMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFN\nFGRGHDLSPLASDILTNTSGSMDEGDDYLPPTTPAVEKIPCFPIESKEEEDKTEQAKVTG\nGQTTQVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPS\nEAVVAESSTGLPPVADDSQPVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFY\nEGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPSSADKSGLSREFDQDRKAN\nDKLDTVLEKSEEHVDSKEHAKESEEVGDKVELFGLGVTYEQTSAKELITTKETAPERAEK\nGLSSVPEVAEVETTTKADQGLDVAAKKDDQSPLDIKVSDFGQMASGMSVDAGKTIELKFE\nVDQQLTLSSEAPQETDSFMGIESSHVKDGAKVSETEVKEKVAKPDLVHQEAVDKEESYES\nSGEHESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADSSIDEKAEVQ\nMEFIQLPKEESTETPDIPAIPSDVTQPQPEAVVSEPAEVRGEEEEIEAEGEYDKLLFRSD\nTLQITDLLVPGSREEFVETCPGEHKGVVESVVTIEDDFITVVQTTTDEGELGSHSVRFAA\nPVQPEEERRPYPHDEELEVLMAAEAQAEPKDGSPDAPATPEKEEVPFSEYKTETYDDYKD\nETTIDDSIMDADSLWVDTQDDDRSILTEQLETIPKEERAEKEARRPSLEKHRKEKPFKTG\nRGRISTPERREVAKKEPSTVSRDEVRRKKAVYKKAELAKESEVQAHSPSRKLILKPAIKY\nTRPTHLSCVKRKTTATSGESAQAPSAFKQAKDKVTDGITKSPEKRSSLPRPSSILPPRRG\nVSGDREENSFSLNSSISSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTP\nGTPGTPSYPRTPGTPKSGILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKI\nGSTDNIKYQPKGGQVRILNKKMDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTS\nKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFRE\nHAKARVDHGAEIITQSPSRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQG\nL",
          "mw": 49.299,
          "total_mw": 49.299,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "MOPS map2c buffer",
        "concentration_unit": null,
        "comment": "50 mM MOPS pH 6.9, 100 mM NaCl, 0.5 mM TCEP, 10 mM NaN3",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.9,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Phosphorylated Microtubule associated protein MAP2c (isoform 3); 1.7 mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "MUNI",
            "address": "Brno, Czech Republic",
            "full_name": "Masaryk University;   \tResearch group Structure and Dynamics of Proteins.",
            "webpage": "https://www.muni.cz/"
          }
        ],
        "contributor_name": "Vojtech",
        "contributor_surname": "Zapletal",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-04-21",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 10,
    "wavelength": 0.099,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 1.7,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.031,
    "s_max": 4.944,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of phosphorylated microtubule associated protein MAP2c (isoform 3) in 50 mM MOPS, 150 mM NaCl, 0,03% NaN3, pH 6.9 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at an X-ray wavelength, λ, of 0.099 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 1.70 mg/ml was measured at 20°C. A total of 10 successive 1 s data frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the data were scaled for protein concentration.",
  "tags": [
    "idp"
  ],
  "intensity_unit": null,
  "experimental_mw": 66.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 28.9,
  "guinier_i0_error": 0.12,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 6.68,
  "guinier_rg_error": 0.27,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 9,
  "guinier_point_last": 32,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDC2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDC2",
  "status": "success",
  "started_at": "2026-08-11T13:35:13.607165+00:00",
  "finished_at": "2026-08-11T13:35:20.621450+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDC2/",
      "path": "/data/saxsdb/sasbdb/entries/c2/sasddc2/source/summary.json",
      "size": 8356,
      "sha256": "8f0f684bb9d1d5f0550699c54b575249124b52c8ff3e7751ee42f428b0c7c917"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDC2.dat",
      "path": "/data/saxsdb/sasbdb/entries/c2/sasddc2/source/SASDDC2.dat",
      "size": 57604,
      "sha256": "a8a57c8b963b6642e04df9bb51addff9b711474b3870b313611258d4e45169bd",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/c2/sasddc2/source/SASDDC2.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDC2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/c2/sasddc2/source/SASDDC2.sascif",
      "size": 62200,
      "sha256": "2edc2bd2e2b9800efaf91929b8e204c703d2e50f672d81cfa0106a2a4a05c409",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDC2.zip",
      "path": "/data/saxsdb/sasbdb/entries/c2/sasddc2/source/SASDDC2.zip",
      "size": 17800,
      "sha256": "04369fbc9a02ff8723195d38547e9865e8c0510cd53703e4aad0325f9dcc3910",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}