The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDC9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "The 3-D structure of VNG0258H/RosR - A haloarchaeal DNA-binding protein in its ionic shell.",
"publication": {
"title": "The 3-D structure of VNG0258H/RosR - A haloarchaeal DNA-binding protein in its ionic shell.",
"author_list": "Kutnowski N, Shmuely H, Dahan I, Shmulevich F, Davidov G, Shahar A, Eichler J, Zarivach R, Shaanan B",
"journal": "J Struct Biol",
"doi": "10.1016/j.jsb.2018.08.008",
"pmid": "30110657",
"published_date": "2018 Aug 12"
},
"status": "released",
"submitted_date": "2018-06-29",
"released_date": "2018-08-15"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDC9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDC9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDC9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDC9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDC9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "VNG0258H/RosR",
"short_name": "VNG0258H/RosR",
"sequence": ">VNG0258H/RosR\r\nMSEAQPDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDL\r\nVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVETIVADDAAAL\r\nEHHHHHH",
"organism": "Halobacterium salinarum NRC-1",
"uniprot_code": "Q9HSF4",
"uniprot_range_first": 1,
"uniprot_range_last": 116,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSEAQPDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDL\nVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVETIVADD",
"mw": 14.533,
"total_mw": 29.066,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM HEPES, 2 M RbCl, 0.02% NaN3",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Structure of Halobacterium salinarum VNG0258H/RosR in the presence of 2 M RbCl",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Israel",
"full_name": "Ben-Gurion University of the Negev",
"webpage": "https://in.bgu.ac.il/"
}
],
"contributor_name": "Nitzan",
"contributor_surname": "kutnowski",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-03-07",
"storage_temperature": 25.0,
"cell_temperature": 25.0,
"exposure_time": 2.0,
"number_of_frames": 10,
"wavelength": 0.09919,
"sample_detector_distance": 2.864,
"concentration_min": null,
"concentration_max": 5.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.034,
"s_max": 4.975,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDC9_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDC9_fit1_model1.pdb",
"model_mw": 39.36,
"bead_radius": 3.3,
"log": null,
"symmetry": null,
"comment": null,
"user": 339
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/2M_RbCl_SASDDC9_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5",
"model_data": "https://www.sasbdb.org/media/pdb_file/2M_RbCl_SASDDC9.pdb",
"model_mw": 31.79,
"bead_radius": 2.0,
"log": null,
"symmetry": null,
"comment": null,
"user": 339
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDC9_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.225272,
"p_value": 0.442257,
"fit_residual_plot": "SASDDC9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDC9_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": "Individual (top) and spatially averaged (DAMFILT, bottom) ab initio models are displayed.",
"experiment_description": "Synchrotron SAXS data from solutions of Halobacterium salinarum VNG0258H/RosR in 50 mM HEPES, 2 M RbCl, 0.02% NaN3, pH 7 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.09919 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.10 mg/ml was measured at 25°C. 10 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 42.26,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 55.0,
"porod_mw_error": null,
"pddf_i0": 12.26,
"pddf_i0_error": 0.05,
"guinier_i0": 13.04,
"guinier_i0_error": 0.056,
"pddf_rg": 3.1,
"pddf_rg_error": 0.01,
"guinier_rg": 3.28,
"guinier_rg_error": 0.43,
"pddf_dmax": 9.3,
"pddf_dmax_error": null,
"porod_volume": 89.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 29,
"guinier_point_last": 77,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDC9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDC9",
"status": "success",
"started_at": "2026-08-11T16:11:11.753425+00:00",
"finished_at": "2026-08-11T16:11:20.072875+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDC9/",
"path": "/data/saxsdb/sasbdb/entries/c9/sasddc9/source/summary.json",
"size": 7748,
"sha256": "2d05443d47e23898886248dca6ae087c0c8f5cd3e8b018da81f00895dcea26e4"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDC9.dat",
"path": "/data/saxsdb/sasbdb/entries/c9/sasddc9/source/SASDDC9.dat",
"size": 57365,
"sha256": "d00b3c8d130a40f8aa3e8461086c70d33e2cc4e70e3e705b634d7f706daebe72",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDC9.out",
"path": "/data/saxsdb/sasbdb/entries/c9/sasddc9/source/SASDDC9.out",
"size": 29502,
"sha256": "92295e127ea6621aa3ee80fbdcafd32030c13957457fa1c40205376ec7db2d52",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDC9.sascif",
"path": "/data/saxsdb/sasbdb/entries/c9/sasddc9/source/SASDDC9.sascif",
"size": 280542,
"sha256": "5c842b1f3a1d207573e77bd1e30c701375dc37ca013f4c2539d89cdd1381536c",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDC9.zip",
"path": "/data/saxsdb/sasbdb/entries/c9/sasddc9/source/SASDDC9.zip",
"size": 49518,
"sha256": "4004a33887b88ec8f4b54fa8bd321fd698d94c7278dee44c4835e44e9e9ca2ea",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
