The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDD5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Conformational States of ABC Transporter MsbA in a Lipid Environment Investigated by Small-Angle Scattering Using Stealth Carrier Nanodiscs.",
"publication": {
"title": "Conformational States of ABC Transporter MsbA in a Lipid Environment Investigated by Small-Angle Scattering Using Stealth Carrier Nanodiscs.",
"author_list": "Josts I, Nitsche J, Maric S, Mertens HD, Moulin M, Haertlein M, Prevost S, Svergun DI, Busch S, Forsyth VT, Tidow H",
"journal": "Structure",
"doi": "10.1016/j.str.2018.05.007",
"pmid": "29937358",
"published_date": "2018 Aug 7"
},
"status": "released",
"submitted_date": null,
"released_date": "2018-06-27"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDD5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDD5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDD5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDD5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Lipid A export ATP-binding/permease protein MsbA",
"short_name": "MsbA",
"sequence": "MHHHHHHGENLYFQGSHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD\r\nRSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS\r\nTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI\r\nAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ\r\nGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS\r\nLTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR\r\nNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA\r\nLVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL\r\nLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS\r\nTIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ",
"organism": "Escherichia coli",
"uniprot_code": "P60752",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD\nRSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS\nTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI\nAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ\nGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS\nLTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR\nNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA\nLVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL\nLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS\nTIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ",
"mw": 66.279,
"total_mw": 132.558,
"number_molecules": 2,
"complex_state": false,
"deuteration": 0.0,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Membrane scaffold protein 1D1 (deuterated, 75%)",
"short_name": "d75-msp1d1",
"sequence": "GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEM\r\nSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQE\r\nKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY\r\nHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 24.661,
"total_mw": 49.322,
"number_molecules": 0,
"complex_state": false,
"deuteration": 75.0,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "1-palmitoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine (deuteration: 78% head, 92% acyl)",
"short_name": "d(78,92)-POPC",
"sequence": "C42H82NO8P",
"organism": "Escherichia coli",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "unknown",
"molecular_type": "other",
"uniprot_sequence": null,
"mw": 0.76,
"total_mw": 0.76,
"number_molecules": 124,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "30 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": "nanodisc buffer",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "MsbA in stealth nanodisc (SAXS)",
"ext_coefficient": null,
"contrast": 2.644,
"specific_vol": 0.745,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": "A280",
"concentration_unit": null,
"date": "2017-09-08",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.3,
"concentration_min": 1.0,
"concentration_max": 2.7,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.025,
"s_max": 5.064,
"total_exposure_time": 1.0,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "2.8.3",
"i0_calibration_standard": "water",
"description": "MsbA ABC transporter protein encapsulated in a partially deuterated \"stealth-nanodisc\": (sND). Disc components (MSP1D1 scaffold protein - 75% deuterated, and POPC lipid - heads/tails 78% and 92% deuterated). The expected molecular weight for this protein-lipid complex should correspond to that of the MsbA protein (~132 kDa) + 2 x MSP1D1 (2 x 24.7 kDa) + the contribution of the POPC lipids (760 Da per monomer).",
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 206.6,
"experimental_mw_error": 20.0,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 379.0,
"porod_mw_error": 40.0,
"pddf_i0": 0.13,
"pddf_i0_error": 0.003,
"guinier_i0": 0.125,
"guinier_i0_error": 0.003,
"pddf_rg": 4.75,
"pddf_rg_error": 0.1,
"guinier_rg": 4.78,
"guinier_rg_error": 0.2,
"pddf_dmax": 16.0,
"pddf_dmax_error": 0.5,
"porod_volume": 607.0,
"porod_volume_error": 60.0,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 10,
"guinier_point_last": 80,
"pddf_point_first": 4,
"pddf_point_last": 784,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDD5_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDD5",
"status": "success",
"started_at": "2026-08-11T14:45:28.571126+00:00",
"finished_at": "2026-08-11T14:45:36.975819+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDD5/",
"path": "/data/saxsdb/sasbdb/entries/d5/sasddd5/source/summary.json",
"size": 8659,
"sha256": "99da9fa4546c40577e8cbccd143c8caa7b1e76402463c71aa97b8bd39581b620"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDD5.dat",
"path": "/data/saxsdb/sasbdb/entries/d5/sasddd5/source/SASDDD5.dat",
"size": 84030,
"sha256": "e5878a894f80ed0effb8fc284f792c14f7695241b85e6a6d86c1af4b3622d6f8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDD5.out",
"path": "/data/saxsdb/sasbdb/entries/d5/sasddd5/source/SASDDD5.out",
"size": 72258,
"sha256": "0120c085a6b428bd2a86b96096ba4dd7de84f4df28554acb964e05736310ab12",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDD5.sascif",
"path": "/data/saxsdb/sasbdb/entries/d5/sasddd5/source/SASDDD5.sascif",
"size": 150733,
"sha256": "6ede0b9c5c0772b8296480a49006ef24942d5dab844afd173c0b408c0000b5a2",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDD5.zip",
"path": "/data/saxsdb/sasbdb/entries/d5/sasddd5/source/SASDDD5.zip",
"size": 44177,
"sha256": "0692e1a9f6f7232136b5896e6d04798a4fa10773ca17989a63eb6852b1b3c7f0",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
