The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDD6",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Integrative dynamic structural biology unveils conformers essential for the oligomerization of a large GTPase.",
"publication": {
"title": "Integrative dynamic structural biology unveils conformers essential for the oligomerization of a large GTPase.",
"author_list": "Peulen TO, Hengstenberg CS, Biehl R, Dimura M, Lorenz C, Valeri A, Folz J, Hanke CA, Ince S, Vöpel T, Farago B, Gohlke H, Klare JP, Stadler AM, Seidel CAM, Herrmann C",
"journal": "Elife",
"doi": "10.7554/eLife.79565",
"pmid": "37314846",
"published_date": "2023 Jun 14"
},
"status": "released",
"submitted_date": "2018-05-08",
"released_date": "2019-12-02"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDD6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDD6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDD6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDD6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Guanylate-binding protein 1",
"short_name": null,
"sequence": ">sp|P32455|1-589\r\nMASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG\r\nKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV\r\nLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW\r\nTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR\r\nPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY\r\nVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETLQELLDLHRDS\r\nEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE\r\nEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ\r\nTLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRV\r\nQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKAC",
"organism": "Homo sapiens",
"uniprot_code": "P32455",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG\nKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV\nLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW\nTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR\nPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY\nVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETLQELLDLHRDS\nEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE\nEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ\nTLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRV\nQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS",
"mw": 67.629,
"total_mw": 67.629,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM TRIS, 5 mM MgCl2, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.9,
"deuteration": null
},
"purity_method": null,
"name": "Human Guanylate-binding protein (hGBP1)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Germany",
"full_name": "Forschungszentrum Jülich",
"webpage": "https://www.fz-juelich.de"
}
],
"contributor_name": "Andreas",
"contributor_surname": "Stadler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-04-30",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 114,
"wavelength": 0.099,
"sample_detector_distance": 2.876,
"concentration_min": null,
"concentration_max": 16.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.061,
"s_max": 4.944,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDD6_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.7.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDD6_fit1_model1.pdb",
"model_mw": 71.897,
"bead_radius": 3.25,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDD6_fit1_model2_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.8.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDD6_fit1_model2.pdb",
"model_mw": 71.8,
"bead_radius": 1.5,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDD6_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 2.95,
"p_value": 0.0,
"fit_residual_plot": "SASDDD6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDD6_fit1.fir",
"fit_log": null,
"software_version": "2.8.3",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Column type: Size exclusion chromatography (Superdex 200 10/300 GL, GE Healthcare)\r\nflow rate: 0.5 ml/min.",
"experiment_description": "Synchrotron SAXS data from solutions of Human Guanylate-binding protein (hGBP1) in 50 mM TRIS, 5 mM MgCl2, 150 mM NaCl, pH 7.9 were collected using SEC-SAXS on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The SEC-column load concentration was 16.10 mg/ml (100 µl injection volume). 114 successive 1 second frames were collected through the elution peak, measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of an appropriate solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 65.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 66.1,
"porod_mw_error": null,
"pddf_i0": 66.1,
"pddf_i0_error": null,
"guinier_i0": 65.9,
"guinier_i0_error": 0.06,
"pddf_rg": 4.018,
"pddf_rg_error": null,
"guinier_rg": 3.89,
"guinier_rg_error": 0.06,
"pddf_dmax": 14.4,
"pddf_dmax_error": null,
"porod_volume": 104.9,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 31,
"guinier_point_last": 52,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDD6_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-19T11:14:52.084807+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDD6",
"status": "success",
"started_at": "2026-08-11T15:06:47.440307+00:00",
"finished_at": "2026-08-11T15:06:56.947654+00:00",
"source_last_modified": "2023-06-19T11:14:52.084807+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDD6/",
"path": "/data/saxsdb/sasbdb/entries/d6/sasddd6/source/summary.json",
"size": 8894,
"sha256": "7461e435d1038fe640e630570f5676a921a806c8755c9c0b762d241ac156bd60"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDD6.dat",
"path": "/data/saxsdb/sasbdb/entries/d6/sasddd6/source/SASDDD6.dat",
"size": 47242,
"sha256": "63018dda9f412b0ddd2ea4191ae5f3570cd22c0b6a341f709b34e2958655c103",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDD6.out",
"path": "/data/saxsdb/sasbdb/entries/d6/sasddd6/source/SASDDD6.out",
"size": 41889,
"sha256": "303eb752c60a907e762389f12f88478bd131b5b97c568951a2dbb2bf3d8f90f7",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDD6.sascif",
"path": "/data/saxsdb/sasbdb/entries/d6/sasddd6/source/SASDDD6.sascif",
"size": 898788,
"sha256": "402c9c1301611c0c056c1db4f787db0c0d21aaef3b83600ac281153ab67b2b23",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDD6.zip",
"path": "/data/saxsdb/sasbdb/entries/d6/sasddd6/source/SASDDD6.zip",
"size": 90718,
"sha256": "77c1ee9246d92a28f4bcdbe132ec725675cc3711e12c626f34010c4ad67d8d3f",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
