The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDD9",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/A",
"project": {
"title": "A Highly Conserved Yet Flexible Linker Is Part of a Polymorphic Protein-Binding Domain in Myosin-Binding Protein C.",
"publication": {
"title": "A Highly Conserved Yet Flexible Linker Is Part of a Polymorphic Protein-Binding Domain in Myosin-Binding Protein C.",
"author_list": "Michie KA, Kwan AH, Tung CS, Guss JM, Trewhella J",
"journal": "Structure",
"doi": "10.1016/j.str.2016.08.018",
"pmid": "27720588",
"published_date": "2016 Nov 1"
},
"status": "released",
"submitted_date": "2018-07-05",
"released_date": "2018-07-06"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDD9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDD9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDD9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDD9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDD9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "cardiac myosin binding protein C: tri-helix bundle-C2",
"short_name": "tri-helix bundle-C2",
"sequence": "GPGSEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE",
"organism": "human sequence obtained using E. coli expression",
"uniprot_code": "Q14896",
"uniprot_range_first": 319,
"uniprot_range_last": 451,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE\nGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA\nPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG\nASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE\nVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK\nKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK\nKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT\nLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE\nGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV\nQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK\nLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV\nVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE\nTEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI\nSNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV\nVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG\nLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE\nPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS\nIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL\nNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF\nSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML\nCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG\nEARCECRLEVRVPQ",
"mw": 15.474,
"total_mw": 15.474,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "150 mM NaCl, 10 mM MES, 2 mM TCEP, 1 mM NaN3 at 4°C",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "Cardiac myosin binding protein C: tri-helix bundle from the motif with C2 domain",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Sydney, New South Wales 2006, Australia",
"full_name": "School of Molecular Bioscience, University of Sydney.",
"webpage": ""
}
],
"contributor_name": "Jill",
"contributor_surname": "Trewhella",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-04-18",
"storage_temperature": null,
"cell_temperature": 22.0,
"exposure_time": 1.0,
"number_of_frames": 26,
"wavelength": 0.10332,
"sample_detector_distance": 2.68024,
"concentration_min": 0.98,
"concentration_max": 4.89,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.096,
"s_max": 3.436,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDD9_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDD9_fit1_model1.pdb",
"model_mw": 15.47,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "one state of 2-state MultiFoXS model, weight 0.753",
"user": 138
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDD9_fit1_model2_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDD9_fit1_model2.pdb",
"model_mw": 15.47,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "one state of 2-state MultiFoXS model, weight 0.247",
"user": 138
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDD9_fit1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 3.566712,
"p_value": 0.82,
"fit_residual_plot": "SASDDD9_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDD9_fit1.dat",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDD9_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 3.568,
"p_value": 0.967603,
"fit_residual_plot": "SASDDD9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDD9_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Size_distr_001_1.txt",
"software_version": "on-line",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The concentration series SAXS data and EOM models are provided in the full entry zip archive.",
"experiment_description": "Synchrotron SAXS data from solutions of the cardiac myosin binding protein C tri-helixmotif bundle and C2 domain in 150 mM NaCl, 10 mM MES, 2 mM TCEP, 1 mM NaN3, pH 6.5 (at 4°C) were collected at the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 2.7 m and at a wavelength of λ = 0.10332 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1.0 and 4.9 mg/ml were measured in batch mode. Data were reduced to I(s) versus s using the software ScatterBrain (http://www.synchrotron.org.au/aussyncbeamlines/saxswaxs/software-saxswaxs). Intensities were placed on an absolute scale using the known scattering from H2O. Samples were prepared by gel fitration with a solvent scattering blank taken from buffer eluted from the gel filtration column was measured before each sample. Scattering profiles were obtained by subtraction of the solvent blank scattering from the protein+solvent scattering and extrapolated to zero concentration in primus qt.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 15.475,
"experimental_mw_error": null,
"guinier_i0_mw": 17.896,
"guinier_i0_mw_error": null,
"porod_mw": 13.067,
"porod_mw_error": null,
"pddf_i0": 0.04606,
"pddf_i0_error": 5e-05,
"guinier_i0": 0.046,
"guinier_i0_error": 0.0001,
"pddf_rg": 1.99,
"pddf_rg_error": 0.05,
"guinier_rg": 1.91,
"guinier_rg_error": 0.08,
"pddf_dmax": 8.0,
"pddf_dmax_error": null,
"porod_volume": 19.6,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 18,
"guinier_point_last": 146,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDD9_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:28:13.929013+02:00",
"bragg_peak": []
}
