The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDF3",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural Study of the Complex Formed by Ceruloplasmin and Macrophage Migration Inhibitory Factor.",
"publication": {
"title": "Structural Study of the Complex Formed by Ceruloplasmin and Macrophage Migration Inhibitory Factor.",
"author_list": "Sokolov AV, Dadinova LA, Petoukhov MV, Bourenkov G, Dubova KM, Amarantov SV, Volkov VV, Kostevich VA, Gorbunov NP, Grudinina NA, Vasilyev VB, Samygina VR",
"journal": "Biochemistry (Mosc)",
"doi": "10.1134/S000629791806007X",
"pmid": "30195326",
"published_date": "2018 Jun"
},
"status": "released",
"submitted_date": "2018-02-06",
"released_date": "2018-02-08"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDF3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDF3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDF3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDF3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDF3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDF3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDF3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "linear",
"name": "Braun OED 50M position-sensitive",
"resolution": 0.0
},
"name": null,
"city": "Moscow",
"country": "Russian Federation",
"beamline_name": "HECUS System-3",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Macrophage migration inhibitory factor",
"short_name": "MIF",
"sequence": ">sp|P14174|MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens GN=MIF PE=1 SV=4\r\nMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC\r\nSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA",
"organism": "Homo sapiens",
"uniprot_code": "P14174",
"uniprot_range_first": 1,
"uniprot_range_last": 115,
"oligomerization": "trimer",
"molecular_type": "protein",
"uniprot_sequence": "MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC\nSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA",
"mw": 12.476,
"total_mw": 37.428,
"number_molecules": 3,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Ceruloplasmin",
"short_name": "CP",
"sequence": ">sp|P00450|CERU_HUMAN Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1\r\nMKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP\r\nDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH\r\nSHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH\r\nSHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC\r\nSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH\r\nGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS\r\nSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY\r\nKKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV\r\nRFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY\r\nSAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF\r\nTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF\r\nSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR\r\nQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK\r\nKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ\r\nTESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC\r\nRRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA\r\nINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP\r\nGTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG",
"organism": "Homo sapiens",
"uniprot_code": "P00450",
"uniprot_range_first": 1,
"uniprot_range_last": 1065,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP\nDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH\nSHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH\nSHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC\nSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH\nGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS\nSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY\nKKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV\nRFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY\nSAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF\nTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF\nSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR\nQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK\nKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ\nTESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC\nRRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA\nINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP\nGTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG",
"mw": 122.204,
"total_mw": 122.204,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50mkm CuSO4, 100mM Hepes",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Macrophage migration inhibitory factor bound to Ceruloplasmin (MIF-CP complex)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "MSU",
"address": "Moscow, Russia",
"full_name": "Lomonosov Moscow State University",
"webpage": "http://www.msu.ru"
}
],
"contributor_name": "Liubov",
"contributor_surname": "Dadinova",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-12-22",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 5400.0,
"number_of_frames": 1,
"wavelength": 0.154,
"sample_detector_distance": 0.28,
"concentration_min": 5.0,
"concentration_max": 10.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.191,
"s_max": 2.488,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDF3_fit1_model1_img.png",
"software": "ClusPro",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDF3_fit1_model1.pdb",
"model_mw": 155.1,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 35
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDF3_fit1_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.224,
"p_value": 0.004219,
"fit_residual_plot": "SASDDF3_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDF3_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/model202.log",
"software_version": "5,0",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of macrophage migration inhibitory factor bound to Ceruloplasmin (MIF-CP complex) in 50mM CuSO4, 100mM HEPES, pH 7.4 were collected using a HECUS System-3 instrument (Moscow, Russian Federation) with a linear Braun OED 50M position-sensitive detector at a sample to detector distance of 0.3 m and at a wavelength of λ = 0.154 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 5 and 10 mg/ml were measured at 20°C. One 5400 second frame was collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 138.0,
"experimental_mw_error": null,
"guinier_i0_mw": 138.0,
"guinier_i0_mw_error": 7.0,
"porod_mw": 142.5,
"porod_mw_error": null,
"pddf_i0": 14030.0,
"pddf_i0_error": 1554.0,
"guinier_i0": 13053.0,
"guinier_i0_error": 755.0,
"pddf_rg": 3.94,
"pddf_rg_error": 0.5,
"guinier_rg": 3.56,
"guinier_rg_error": 0.3,
"pddf_dmax": 14.41,
"pddf_dmax_error": 0.5,
"porod_volume": 228.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 22,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDF3_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
