The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDG8",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Integrin α6β4 Recognition of a Linear Motif of Bullous Pemphigoid Antigen BP230 Controls Its Recruitment to Hemidesmosomes.",
"publication": {
"title": "Integrin α6β4 Recognition of a Linear Motif of Bullous Pemphigoid Antigen BP230 Controls Its Recruitment to Hemidesmosomes.",
"author_list": "Manso JA, Gómez-Hernández M, Carabias A, Alonso-García N, García-Rubio I, Kreft M, Sonnenberg A, de Pereda JM",
"journal": "Structure",
"doi": "10.1016/j.str.2019.03.016",
"pmid": "31006587",
"published_date": "2019 Jun 4"
},
"status": "released",
"submitted_date": "2018-06-07",
"released_date": "2019-03-14"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDG8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDG8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDG8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDG8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDG8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDG8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDG8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Integrin beta-4 (1436-1666) R1463A",
"short_name": "B4 CS-FnIII-3,4",
"sequence": "GSHM LPRDY\r\nSTLTSVSSHDSRLTAGVPDTPTALVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGG\r\nELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCP \r\nLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATAF\r\nRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIES",
"organism": "Homo sapiens",
"uniprot_code": "P16144",
"uniprot_range_first": 1436,
"uniprot_range_last": 1666,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR\nCNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL\nEVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV\nPQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL\nQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR\nTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE\nEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG\nTHVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCV\nCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN\nFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR\nCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE\nLKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL\nLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR\nSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC\nAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK\nLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL\nLVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG\nKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH\nVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS\nRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG\nAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV\nNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP\nKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLG\nEELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGE\nHLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEH\nSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGY\nSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIES\nQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM\nAQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGG\nPFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEF\nVSRTLTTSGTLSTHMDQQFFQT",
"mw": 25.52,
"total_mw": 25.52,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Sodium Phosphate 150 mM NaCl 5% glycerol 3 mM DTT",
"concentration_unit": "mM",
"comment": null,
"additive": "150 mM NaCl, 5% glycerol, 3 mM DTT",
"concentration": 20.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Integrin beta4, fragment of the cytoplasmic region that includes the final part of the connecting segment and the third and fourth FnIII domains (FnIII-3,4). Point mutant R1463A",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "USAL",
"address": "Salamanca, Spain",
"full_name": "La Universidad de Salamanca",
"webpage": "http://www.usal.es"
}
],
"contributor_name": "Jose M",
"contributor_surname": "de Pereda",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-11-26",
"storage_temperature": null,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 30,
"wavelength": 0.124,
"sample_detector_distance": 3.1,
"concentration_min": 0.9,
"concentration_max": 7.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.056,
"s_max": 4.45,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDG8_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "r9988",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDG8_fit1_model1.pdb",
"model_mw": 24.9,
"bead_radius": 1.5,
"log": null,
"symmetry": null,
"comment": null,
"user": 26
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDG8_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.024,
"p_value": 0.665832,
"fit_residual_plot": "SASDDG8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDG8_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/B460_R1463A_dammif_06.log",
"software_version": "r9988",
"description": null
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDG8_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.032,
"p_value": 0.665832,
"fit_residual_plot": "SASDDG8_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDG8_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/EOM_B460_R1463A_logFile_002_1.log",
"software_version": "2.1",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Synchrotron SAXS data from solutions of a fragment of the cytoplasmic region of the human integrin Beta4 subunit. This fragment includes the final part of a region named the \"connecting segment\" the third and fourth fibronectin type III domains (FnIII-3,4). The protein contains the point mutation R1463A. Samples at different solute concentration in the range 0.9 – 7.1 mg/ml were obtained by 2-fold serial dilution and were measured.",
"experiment_description": "Synchrotron SAXS data from solutions of the integrin beta4 fragment (point mutant R1463A) in 20 mM sodium phosphate 150 mM NaCl 5% glycerol 3 mM DTT, pH 7.5 were collected on the EMBL P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3.1 m and at a wavelength of λ = 0.124 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.9 and 7.1 mg/ml were measured at 10°C. 30 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 22.71,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 24.1,
"porod_mw_error": null,
"pddf_i0": 0.01637,
"pddf_i0_error": null,
"guinier_i0": 0.0164,
"guinier_i0_error": null,
"pddf_rg": 2.444,
"pddf_rg_error": null,
"guinier_rg": 2.417,
"guinier_rg_error": null,
"pddf_dmax": 9.5,
"pddf_dmax_error": null,
"porod_volume": 36.1,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 184,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDG8_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDG8",
"status": "success",
"started_at": "2026-08-11T15:52:54.147763+00:00",
"finished_at": "2026-08-11T15:53:03.090250+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDG8/",
"path": "/data/saxsdb/sasbdb/entries/g8/sasddg8/source/summary.json",
"size": 10574,
"sha256": "a04475903daf6af81214c20c911ecc25f9d491a5e576904971e9c8e83fc5a894"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDG8.dat",
"path": "/data/saxsdb/sasbdb/entries/g8/sasddg8/source/SASDDG8.dat",
"size": 76938,
"sha256": "6e80f76bb1e81a48ced537b9ec7d92db00d8367ce7481af847d7c0e743b3b04e",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDG8.out",
"path": "/data/saxsdb/sasbdb/entries/g8/sasddg8/source/SASDDG8.out",
"size": 100172,
"sha256": "150391effd0087d416105cf6355b0267e2c44413559aa794e8ec56bb0d5639bd",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDG8.sascif",
"path": "/data/saxsdb/sasbdb/entries/g8/sasddg8/source/SASDDG8.sascif",
"size": 528831,
"sha256": "e251786e47c35cd4290410285dc2da2904d486c004fe259fb25de0362028ac74",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDG8.zip",
"path": "/data/saxsdb/sasbdb/entries/g8/sasddg8/source/SASDDG8.zip",
"size": 104780,
"sha256": "249c4dd9be70ecc028dfe45f748719d4100b9b78f5cbe8f0e1e5a971d713ed70",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
