Chloroplastic phosphoribulokinase (collected using SEC-SAXS)

{
  "code": "SASDDH9",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/nm",
  "project": {
    "title": "<i>Arabidopsis</i> and <i>Chlamydomonas</i> phosphoribulokinase crystal structures complete the redox structural proteome of the Calvin-Benson cycle.",
    "publication": {
      "title": "<i>Arabidopsis</i> and <i>Chlamydomonas</i> phosphoribulokinase crystal structures complete the redox structural proteome of the Calvin-Benson cycle.",
      "author_list": "Gurrieri L, Del Giudice A, Demitri N, Falini G, Pavel NV, Zaffagnini M, Polentarutti M, Crozet P, Marchand CH, Henri J, Trost P, Lemaire SD, Sparla F, Fermani S",
      "journal": "Proc Natl Acad Sci U S A",
      "doi": "10.1073/pnas.1820639116",
      "pmid": "30923119",
      "published_date": "2019 Apr 16"
    },
    "status": "released",
    "submitted_date": "2018-07-05",
    "released_date": "2019-03-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDH9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDH9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDH9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDH9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDH9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDH9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDH9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Phosphoribulokinase, chloroplastic",
          "short_name": "CrPRK",
          "sequence": "GSHMDKDKTVVIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGG\r\nNPDSNTLISDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMYNQVKALKEGKSVDKPIYNHVSGL\r\nIDAPEKIESPPILVIEGLHPFYDKRVAELLDFKIYLDISDDIKFAWKIQRDMAERGHSLESIKSSIAARK\r\nPDFDAYIDPQKKDADMIIQVLPTQLVPDDKGQYLRVRLIMKEGSKMFDPVYLFDEGSTISWIPCGRKLTC\r\nSFPGIKMFYGPDTWYGQEVSVLEMDGQFDKLEELIYVESHLSNTSAKFYGEITQQMLKNSGFPGSNNGTG\r\nLFQTIVGLKVREVYERIVKKDVVPV",
          "organism": "Chlamydomonas reinhardtii",
          "uniprot_code": "P19824",
          "uniprot_range_first": 32,
          "uniprot_range_last": 375,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAFTMRAPAPRATAQSRVTANRARRSLVVRADKDKTVVIGLAADSGCGKSTFMRRMTSIF\nGGVPKPPAGGNPDSNTLISDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMYNQV\nKALKEGKSVDKPIYNHVSGLIDAPEKIESPPILVIEGLHPFYDKRVAELLDFKIYLDISD\nDIKFAWKIQRDMAERGHSLESIKSSIAARKPDFDAYIDPQKKDADMIIQVLPTQLVPDDK\nGQYLRVRLIMKEGSKMFDPVYLFDEGSTISWIPCGRKLTCSFPGIKMFYGPDTWYGQEVS\nVLEMDGQFDKLEELIYVESHLSNTSAKFYGEITQQMLKNSGFPGSNNGTGLFQTIVGLKV\nREVYERIVKKDVVPV",
          "mw": 38.908,
          "total_mw": 77.816,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "Tris-HCl 50 mM 150 mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Chloroplastic phosphoribulokinase (collected using SEC-SAXS)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Sapienza",
            "address": "Rome, Italy",
            "full_name": "Sapienza University Rome",
            "webpage": "http://www.uniroma1.it/"
          }
        ],
        "contributor_name": "Alessandra",
        "contributor_surname": "Del Giudice",
        "orcid": "https://orcid.org/0000-0002-1916-8300"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-02-15",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 1.0,
    "number_of_frames": 80,
    "wavelength": 0.099,
    "sample_detector_distance": 2.872,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.122,
    "s_max": 3.502,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDH9_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "6h7g",
              "ext_code": "6H7G",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDDH9_fit1_model1.pdb",
          "model_mw": 75.89,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 341
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/6h7g01_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.222,
      "p_value": 2.1e-05,
      "fit_residual_plot": "6h7g01_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDH9_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/6h7g01.log",
      "software_version": "CRYSOL_30",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Additional SEC parameters: Column type: Superdex 200 10/300 GL (GE Healthcare); Flow rate: 0.5 ml/min; Sample injection concentration: 6.1 mg/ml; Injection volume: 100 µl.",
  "experiment_description": "Synchrotron SAXS data from solutions of chloroplastic phosphoribulokinase (collected using SEC-SAXS) in Tris-HCl 50 mM 150 mM KCl, pH 7.5 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 4°C. 80 successive 1 second frames were collected through the SEC-elution profile. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of an appropriate solvent-blank (eluate SEC-buffer) was subtracted.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 70.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": 70.0,
  "guinier_i0_mw_error": 0.2,
  "porod_mw": 72.0,
  "porod_mw_error": null,
  "pddf_i0": 42.42,
  "pddf_i0_error": 0.06,
  "guinier_i0": 42.0,
  "guinier_i0_error": 0.1,
  "pddf_rg": 3.548,
  "pddf_rg_error": 0.008,
  "guinier_rg": 3.43,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 11.3,
  "pddf_dmax_error": null,
  "porod_volume": 115.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 55,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDH9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDH9",
  "status": "success",
  "started_at": "2026-08-11T16:14:56.471281+00:00",
  "finished_at": "2026-08-11T16:15:05.447444+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDH9/",
      "path": "/data/saxsdb/sasbdb/entries/h9/sasddh9/source/summary.json",
      "size": 8304,
      "sha256": "2ecdb3485a4456d8ffbbbfbf953cbc27963dfb09ad4196a6858fe43d43ebd80b"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDH9.dat",
      "path": "/data/saxsdb/sasbdb/entries/h9/sasddh9/source/SASDDH9.dat",
      "size": 42100,
      "sha256": "28fb304e050204860ce4a0a692818c3dbb531b520bd0e9631104bd71593b5c91",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDH9.out",
      "path": "/data/saxsdb/sasbdb/entries/h9/sasddh9/source/SASDDH9.out",
      "size": 52296,
      "sha256": "abddd4f4b0bcf7f8d122530fff2f564ee89b633d57dbed5ddeadecbf190284da",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDH9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/h9/sasddh9/source/SASDDH9.sascif",
      "size": 652874,
      "sha256": "2d4e9e7e0757bd6b27118f2a4d3c1556069e75294401b3eabf400bb44fa77c7d",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDH9.zip",
      "path": "/data/saxsdb/sasbdb/entries/h9/sasddh9/source/SASDDH9.zip",
      "size": 152715,
      "sha256": "23270ca6dc67aa923b9e25648848111a1078dd475f88615c0551572e83d67e6d",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}