The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDN2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structures of Proline Utilization A (PutA) Reveal the Fold and Functions of the Aldehyde Dehydrogenase Superfamily Domain of Unknown Function.",
"publication": {
"title": "Structures of Proline Utilization A (PutA) Reveal the Fold and Functions of the Aldehyde Dehydrogenase Superfamily Domain of Unknown Function.",
"author_list": "Luo M, Gamage TT, Arentson BW, Schlasner KN, Becker DF, Tanner JJ",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.M116.756965",
"pmid": "27679491",
"published_date": "2016 Nov 11"
},
"status": "released",
"submitted_date": "2018-01-09",
"released_date": "2018-01-10"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDN2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDN2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDN2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDN2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDN2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 165 CCD",
"resolution": null
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Sinorhizobium meliloti (SmPutA)",
"short_name": "SmPutA",
"sequence": "SMMSPNPLQKPAIDAAPAPFADFAPPVRPQSTLRRAITAAYRRPETECLPPLVEAATQSKEIRDAAASTARKLIEALRGK\r\nHSGSGVEGLVQEYSLSSQEGVALMCLAEALLRIPDTATRDALIRDKIADGNWKSHLGGSRSLFVNAATWGLVVTGKLTST\r\nVNDRSLAAALTRLISRCGEPVIRRGVDMAMRMMGEQFVTGETIREALKRSKELEEKGFSYSYDMLGEAATTAADAERYYR\r\nDYESAIHAIGKASAGRGIYEGPGISIKLSALHPRYSRAQAARVMGELLPRVKALALLAKNYDIGLNIDAEEADRLELSLD\r\nLLEVLCLDGDLSGWNGMGFVVQAYGKRCPFVLDFIIDLARRSGRRIMVRLVKGAYWDAEIKRAQLDGLADFPVFTRKIHT\r\nDVSYIACAAKLLAATDVVFPQFATHNAQTLAAIYHMAGKDFHVGKYEFQCLHGMGEPLYEEVVGRGKLDRPCRIYAPVGT\r\nHETLLAYLVRRLLENGANSSFVHRINDPKVSIDELIADPVEVVRAMPVVGAKHDRIALPAELFGDARTNSAGLDLSNEET\r\nLASLTEALRESAAMKWTALPQLATGPAAGETRTVLNPGDHRDVVGSVTETSEEDARRAVRLAADAAPDWAAVPPSERAAC\r\nLDRAAELMQARMPTLLGLIIREAGKSALNAIAEVREAIDFLRYYAEQTRRTLGPGHGPLGPIVCISPWNFPLAIFTGQIA\r\nAALVAGNPVLAKPAEETPLIAAEGVRILREAGIPASALQLLPGDGRVGAALVAAAETAGVMFTGSTEVARLIQAQLADRL\r\nSPAGRPIPLIAETGGQNAMIVDSSALAEQVVGDVITSAFDSAGQRCSALRVLCLQEDVADRILTMLKGALHELHIGRTDR\r\nLSVDVGPVITSEAKDNIEKHIERMRGLGRKVEQIGLASETGVGTFVPPTIIELEKLSDLQREVFGPVLHVIRYRRDDLDR\r\nLVDDVNATGYGLTFGLHTRLDETIAHVTSRIKAGNLYINRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVTTAPVP\r\nPQHSSVHTDPVLLDFAKWLDGKGARAEAEAARNAGSSSALGLDLELPGPVGERNLYTLHARGRILLVPATESGLYHQLAA\r\nALATGNSVAIDAASGLQASLKNLPQTVGLRVSWSKDWAADGPFAGALVEGDAERIRAVNKAIAALPGPLLLVQAASSGEI\r\nARNPDAYCLNWLVEEVSASINTAAAGGNASLMAIG",
"organism": "Sinorhizobium meliloti",
"uniprot_code": "F7X6I3",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSPNPLQKPAIDAAPAPFADFAPPVRPQSTLRRAITAAYRRPETECLPPLVEAATQSKEI\nRDAAASTARKLIEALRGKHSGSGVEGLVQEYSLSSQEGVALMCLAEALLRIPDTATRDAL\nIRDKIADGNWKSHLGGSRSLFVNAATWGLVVTGKLTSTVNDRSLAAALTRLISRCGEPVI\nRRGVDMAMRMMGEQFVTGETIREALKRSKELEEKGFSYSYDMLGEAATTAADAERYYRDY\nESAIHAIGKASAGRGIYEGPGISIKLSALHPRYSRAQAARVMGELLPRVKALALLAKNYD\nIGLNIDAEEADRLELSLDLLEVLCLDGDLSGWNGMGFVVQAYGKRCPFVLDFIIDLARRS\nGRRIMVRLVKGAYWDAEIKRAQLDGLADFPVFTRKIHTDVSYIACAAKLLAATDVVFPQF\nATHNAQTLAAIYHMAGKDFHVGKYEFQCLHGMGEPLYEEVVGRGKLDRPCRIYAPVGTHE\nTLLAYLVRRLLENGANSSFVHRINDPKVSIDELIADPVEVVRAMPVVGAKHDRIALPAEL\nFGDARTNSAGLDLSNEETLASLTEALRESAAMKWTALPQLATGPAAGETRTVLNPGDHRD\nVVGSVTETSEEDARRAVRLAADAAPDWAAVPPSERAACLDRAAELMQARMPTLLGLIIRE\nAGKSALNAIAEVREAIDFLRYYAEQTRRTLGPGHGPLGPIVCISPWNFPLAIFTGQIAAA\nLVAGNPVLAKPAEETPLIAAEGVRILREAGIPASALQLLPGDGRVGAALVAAAETAGVMF\nTGSTEVARLIQAQLADRLSPAGRPIPLIAETGGQNAMIVDSSALAEQVVGDVITSAFDSA\nGQRCSALRVLCLQEDVADRILTMLKGALHELHIGRTDRLSVDVGPVITSEAKDNIEKHIE\nRMRGLGRKVEQIGLASETGVGTFVPPTIIELEKLSDLQREVFGPVLHVIRYRRDDLDRLV\nDDVNATGYGLTFGLHTRLDETIAHVTSRIKAGNLYINRNIIGAVVGVQPFGGRGLSGTGP\nKAGGPLYLGRLVTTAPVPPQHSSVHTDPVLLDFAKWLDGKGARAEAEAARNAGSSSALGL\nDLELPGPVGERNLYTLHARGRILLVPATESGLYHQLAAALATGNSVAIDAASGLQASLKN\nLPQTVGLRVSWSKDWAADGPFAGALVEGDAERIRAVNKAIAALPGPLLLVQAASSGEIAR\nNPDAYCLNWLVEEVSASINTAAAGGNASLMAIG",
"mw": 131.805,
"total_mw": 131.805,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris, 1% (v/v) glycerol, 0.5 mM THP, and 50 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "Sinorhizobium meliloti Proline Utilization A (PutA) at 3.00 mg/ml",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "Mizzou",
"address": "Columbia, MO, USA",
"full_name": "University of Missouri-Columbia",
"webpage": "http://missouri.edu/"
}
],
"contributor_name": "John",
"contributor_surname": "Tanner",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-03-27",
"storage_temperature": null,
"cell_temperature": 10.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.1127,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 3.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.131,
"s_max": 3.256,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDN2_fit1_model1_img.png",
"software": "MES-FoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDN2_fit1_model1.pdb",
"model_mw": 127.7,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 166
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDN2_fit1_model2_img.png",
"software": "MES-FoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDN2_fit1_model2.pdb",
"model_mw": 254.1,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 166
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDN2_fit1_fitfoxs_img.png",
"software": "MES-FoXS",
"chi_square_value": 1.37025,
"p_value": 0.0,
"fit_residual_plot": "SASDDN2_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDN2_fit1.dat",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The fit to the SAXS data is shown for a volume-fraction weighted mixture of monomers and dimers. The volume fraction of monomer and dimer are 0.67 and 0.33, respectively.",
"experiment_description": "Synchrotron SAXS data from solutions of Sinorhizobium meliloti proline utilization A (PutA) in 50 mM Tris, 1% (v/v) glycerol, 0.5 mM THP and 50 mM NaCl, pH 7.8, were collected on the 12.3.1 SIBYLS beam line at the Advanced Light Source storage ring (ALS; Berkeley, CA, USA) using a MAR 165 CCD detector at a wavelength of λ = 0.1127 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 10°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 181.67,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 1548.0,
"pddf_i0_error": 4.3,
"guinier_i0": 1566.68,
"guinier_i0_error": 12.0,
"pddf_rg": 3.86,
"pddf_rg_error": null,
"guinier_rg": 3.842,
"guinier_rg_error": 0.04,
"pddf_dmax": 11.81,
"pddf_dmax_error": null,
"porod_volume": 248.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 35,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDN2_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-18T10:05:51.027670+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDN2",
"status": "success",
"started_at": "2026-08-11T13:42:18.506800+00:00",
"finished_at": "2026-08-11T13:42:28.721673+00:00",
"source_last_modified": "2026-05-18T10:05:51.027670+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDN2/",
"path": "/data/saxsdb/sasbdb/entries/n2/sasddn2/source/summary.json",
"size": 10271,
"sha256": "84c701db1faafe34cf3e5718b638437e0a8d61123b9aa6a4875ccd394d64d0dc"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDN2.dat",
"path": "/data/saxsdb/sasbdb/entries/n2/sasddn2/source/SASDDN2.dat",
"size": 23462,
"sha256": "7e3a1e161a1d95036907ac00c2afb9bc780c20b395d8e1459cf3e3532f7e95e0",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDN2.out",
"path": "/data/saxsdb/sasbdb/entries/n2/sasddn2/source/SASDDN2.out",
"size": 48498,
"sha256": "1c1133ea098f64ca76609997f46127db6a13107edfd72a6907bab8de0d51bcc4",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDN2.sascif",
"path": "/data/saxsdb/sasbdb/entries/n2/sasddn2/source/SASDDN2.sascif",
"size": 2869677,
"sha256": "96f0c4b96cfb5f4e7b9e971c41be69689f66bd06e51cd1c438313e60f0ab1777",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDN2.zip",
"path": "/data/saxsdb/sasbdb/entries/n2/sasddn2/source/SASDDN2.zip",
"size": 571803,
"sha256": "01b54bcf67a4d03b41a52d60d6a079194500cbcc74843060196abcd2de0a77b7",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
