Anti-CD32b Antibody Clone 6G08 Antibody Binding Fragment (6G08 F(ab))

{
  "code": "SASDDP6",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Evaluating Anti-CD32b F(ab) Conformation Using Molecular Dynamics and Small-Angle X-Ray Scattering.",
    "publication": {
      "title": "Evaluating Anti-CD32b F(ab) Conformation Using Molecular Dynamics and Small-Angle X-Ray Scattering.",
      "author_list": "Sutton EJ, Bradshaw RT, Orr CM, Frendéus B, Larsson G, Teige I, Cragg MS, Tews I, Essex JW",
      "journal": "Biophys J",
      "doi": "10.1016/j.bpj.2018.03.040",
      "pmid": "30021105",
      "published_date": "2018 Jul 17"
    },
    "status": "released",
    "submitted_date": "2018-05-18",
    "released_date": "2019-05-09"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDP6.dat",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDP6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDP6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDP6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDP6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDP6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDP6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Anti-CD32b Antibody Clone 6G08 Antibody Binding Fragment",
          "short_name": "6G08 F(ab)",
          "sequence": "EVQLLESGGGLVQPGGSLRLSCAASGFTLSSYGISWVRQAPGKGLEWVSGISGSGGNTYYADSVKGRFTISRDNSKNTLY\r\nLQMNSLRAEDTAVYYCASSVGAYANDAFDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV\r\nSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK\r\nQSVLTQPPSASGTPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGDTNRPSGVPDRFSGSKSGTSASLAISGL\r\nRSEDEADYYCAAWDDSLNGPVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPV\r\nKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS",
          "organism": "Homo sapiens",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": null,
          "mw": 45.855,
          "total_mw": 45.855,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50mM HEPES, 150mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Anti-CD32b Antibody Clone 6G08 Antibody Binding Fragment (6G08 F(ab))",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Southampton, UK",
            "full_name": "University of Southampton",
            "webpage": "https://www.southampton.ac.uk/"
          }
        ],
        "contributor_name": "Emma",
        "contributor_surname": "Sutton",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2014-12-05",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 2.0,
    "number_of_frames": 10,
    "wavelength": 0.099,
    "sample_detector_distance": null,
    "concentration_min": 1.25,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.141,
    "s_max": 4.771,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ScÅtter",
  "pddf_software_version": "3.0",
  "i0_calibration_standard": null,
  "description": "Sample concentration series: 1.25mg/ml, 2.5mg/ml and 5mg/ml.",
  "experiment_description": "Synchrotron SAXS data from solutions of Anti-CD32b Antibody Clone 6G08 Antibody Binding Fragment (6G08 F(ab)) in 50mM HEPES, 150mM KCl, pH 7.5, were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1.3 and 5 mg/ml were measured at 20°C. 10 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower sample concentrations were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 44.4,
  "experimental_mw_error": null,
  "guinier_i0_mw": 44.0,
  "guinier_i0_mw_error": null,
  "porod_mw": 40.85,
  "porod_mw_error": null,
  "pddf_i0": 42.43,
  "pddf_i0_error": 0.09977,
  "guinier_i0": 44.38,
  "guinier_i0_error": 0.0225,
  "pddf_rg": 2.54,
  "pddf_rg_error": 0.0,
  "guinier_rg": 2.55,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 7.3,
  "pddf_dmax_error": null,
  "porod_volume": 67.8,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 78,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDP6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDP6",
  "status": "success",
  "started_at": "2026-08-11T15:13:25.398594+00:00",
  "finished_at": "2026-08-11T15:13:32.496585+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDP6/",
      "path": "/data/saxsdb/sasbdb/entries/p6/sasddp6/source/summary.json",
      "size": 6526,
      "sha256": "1cd99018bc6878f6e23da2799ae1bd6da85f9d0676794da36276b3457b7570fa"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDP6.dat",
      "path": "/data/saxsdb/sasbdb/entries/p6/sasddp6/source/SASDDP6.dat",
      "size": 44294,
      "sha256": "834017699a24105d49df307c0da149a0d40e72296f9bb1958cd7bacaa4715300",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDP6.dat",
      "path": "/data/saxsdb/sasbdb/entries/p6/sasddp6/source/SASDDP6.out",
      "size": 7787,
      "sha256": "d4391472be87b60675e37a041295bfc1fc0d4fef5652ee3eb82f5ae908082d8e",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDP6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/p6/sasddp6/source/SASDDP6.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDP6.zip",
      "path": "/data/saxsdb/sasbdb/entries/p6/sasddp6/source/SASDDP6.zip",
      "size": 14261,
      "sha256": "179cfa504c6538f79e6d1e66a61edc331a3741bbd8581ae75e55ab9ac32d92cc",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}