The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDQ9",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "The dynamic nature of the conserved tegument protein UL37 of herpesviruses.",
"publication": {
"title": "The dynamic nature of the conserved tegument protein UL37 of herpesviruses.",
"author_list": "Koenigsberg AL, Heldwein EE",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.RA118.004481",
"pmid": "30166339",
"published_date": "2018 Oct 12"
},
"status": "released",
"submitted_date": "2018-07-16",
"released_date": "2018-09-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDQ9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDQ9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDQ9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDQ9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDQ9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDQ9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDQ9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Pilatus",
"name": "Pilatus 200K",
"resolution": 172.0
},
"name": "Cornell High Energy Synchrotron Source (CHESS)",
"city": "Ithaca, NY",
"country": "USA",
"beamline_name": "G1",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Inner tegument protein",
"short_name": "HSV1 UL37",
"sequence": "GPGSMADRGPPSEAPVVTTSPAGPPSDGPMQRLLASLAGLRQPPTPTAETANGADDPAFLATAKLRAAMAAFLLSGTAIAPADARDCWRPLLEHLCALHRAHGLPETALLAENLPGLLVHRLVVALPEAPDQAFREMEVIKDTILAVTGSDTSHALDSAGLRTAAALGPVRVRQCAVEWIDRWQTVTKSCLAMSPRTSIEALGETSLKMAPVPLGQPSANLTTPAYSLLFPAPFVQEGLRFLALVSNRVTLFSAHLQRIDDATLTPLTRALFTLALVDEYLTTPERGAVVPPPLLAQFQHTVREIDPAIMIPPLEANKMVRSREEVRVSTALSRVSPRSACAPPGTLMARVRTDVAVFDPDVPFLSSSALAVFQPAVSSLLQLGEQPSAGAQQRLLALLQQTWTLIQNTNSPSVVINTLIDAGFTPSHCTHYLSALEGFLAAGVPARTPTGHGLGEVQQLFGCIALAGSNVFGLAREYGYYANYVKTFRRVQGASEHTHGRLCEAVGLSGGVLSQTLARIMGPAVPTEHLASLRRALVGEFETAERRFSSGQPSLLRETALIWIDVYGQTHWDITPTTP",
"organism": "Human alphaherpesvirus 1",
"uniprot_code": "P10221",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MADRGLPSEAPVVTTSPAGPPSDGPMQRLLASLAGLRQPPTPTAETANGADDPAFLATAK\nLRAAMAAFLLSGTAIAPADARDCWRPLLEHLCALHRAHGLPETALLAENLPGLLVHRLVV\nALPEAPDQAFREMEVIKDTILAVTGSDTSHALDSAGLRTAAALGPVRVRQCAVEWIDRWQ\nTVTKSCLAMSPRTSIEALGETSLKMAPVPLGQPSANLTTPAYSLLFPAPFVQEGLRFLAL\nVSNRVTLFSAHLQRIDDATLTPLTRALFTLALVDEYLTTPERGAVVPPPLLAQFQHTVRE\nIDPAIMIPPLEANKMVRSREEVRVSTALSRVSPRSACAPPGTLMARVRTDVAVFDPDVPF\nLSSSALAVFQPAVSSLLQLGEQPSAGAQQRLLALLQQTWTLIQNTNSPSVVINTLIDAGF\nTPSHCTHYLSALEGFLAAGVPARTPTGHGLGEVQQLFGCIALAGSNVFGLAREYGYYANY\nVKTFRRVQGASEHTHGRLCEAVGLSGGVLSQTLARIMGPAVPTEHLASLRRALVGEFETA\nERRFSSGQPSLLRETALIWIDVYGQTHWDITPTTPATPLSALLPVGQPSHAPSVHLAAAT\nQIRFPALEGIHPNVLADPGFVPYVLALVVGDALRATCSAAYLPRPVEFALRVLAWARDFG\nLGYLPTVEGHRTKLGALITLLEPAARGGLGPTMQMADNIEQLLRELYVISRGAVEQLRPL\nVQLQPPPPPEVGTSLLLISMYALAARGVLQDLAERADPLIRQLEDAIVLLRLHMRTLSAF\nFECRFESDGRRLYAVVGDTPDRLGPWPPEAMGDAVSQYCSMYHDAKRALVASLASLRSVI\nTETTAHLGVCDELAAQVSHEDNVLAVVRREIHGFLSVVSGIHARASKLLSGDQVPGFCFM\nGQFLARWRRLSACYQAARAAAGPEPVAEFVQELHDTWKGLQTERAVVVAPLVSSADQRAA\nAIREVMAHAPEDAPPQSPAADRVVLTSRRDLGAWGDYSLGPLGQTTAVPDSVDLSRQGLA\nVTLSMDWLLMNELLRVTDGVFRASAFRPLAGPESPRDLEVRDAGNSLPAPMPMDAQKPEA\nYGHGPRQADREGAPHSNTPVEDDEMIPEDTVAPPTDLPLTSYQ",
"mw": 61.724,
"total_mw": 61.724,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "100 mM HEPES 150 mM NaCl 5% glycerol 0.1 mM tris(2-carboxyethyl)phosphine (TCEP)",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "N-terminal half of herpes simplex virus type-1 inner tegument protein UL37",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Somerville, MA, USA",
"full_name": "Tufts University School of Medicine",
"webpage": "https://www.tufts.edu/"
}
],
"contributor_name": "Andrea",
"contributor_surname": "Koenigsberg",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-06-03",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 2.0,
"number_of_frames": 300,
"wavelength": 0.124662,
"sample_detector_distance": 1.53109,
"concentration_min": null,
"concentration_max": 6.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.074,
"s_max": 2.808,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDQ9_fit1_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDQ9_fit1_model1.pdb",
"model_mw": 60.98,
"bead_radius": 2.75,
"log": null,
"symmetry": "P1, none",
"comment": null,
"user": 343
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDQ9_fit1_model2_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDQ9_fit1_model2.pdb",
"model_mw": 60.575,
"bead_radius": 2.8,
"log": null,
"symmetry": "P1, none",
"comment": null,
"user": 343
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDQ9_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.145,
"p_value": 0.108692,
"fit_residual_plot": "SASDDQ9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDQ9_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Additional SEC parameters: Column type: Superdex 200 Increase 5/150 GE; Flow rate: 0.3 mL/min; Sample injection concentration: 6 mg/ml; Injection volume: 100 µl.",
"experiment_description": "Synchrotron SAXS data, I(s) vs s (where s = 4πsinθ/λ, and 2θ is the scattering angle), were measured from the N-terminal half of herpes simplex virus type-1 inner tegument protein UL37 using continuous-flow size-exclusion chromatography SAXS (SEC-SAXS) on the G1 beam line at the Cornell High Energy Synchrotron Source (CHESS; Ithaca, NY, USA). Data were collected a using a Pilatus 200K detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.125 nm. The SEC mobile phase consisted of 100 mM HEPES, 150 mM NaCl, 5% glycerol ,0.1 mM tris(2-carboxyethyl)phosphine (TCEP), pH 7.5, (4°C). The SAXS data measured from the SEC-elution (sample peak and buffer; 300 successive 2 s frames) were normalized to the intensity of the transmitted beam and radially averaged. The scattering of an appropriate solvent-blank was subtracted from the sample frames to produce the scaled and averaged data displayed in this entry.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 63.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.02785,
"pddf_i0_error": null,
"guinier_i0": 0.02786,
"guinier_i0_error": 8e-05,
"pddf_rg": 3.38,
"pddf_rg_error": null,
"guinier_rg": 3.334,
"guinier_rg_error": 1.4,
"pddf_dmax": 10.4,
"pddf_dmax_error": null,
"porod_volume": 91.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 55,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDQ9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDQ9",
"status": "success",
"started_at": "2026-08-11T16:29:02.382943+00:00",
"finished_at": "2026-08-11T16:29:10.870474+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDQ9/",
"path": "/data/saxsdb/sasbdb/entries/q9/sasddq9/source/summary.json",
"size": 9628,
"sha256": "3eb2e509a7b53519e7034a3ce58ccff97059812aafeed7727a81ad9c32dfd50d"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDQ9.dat",
"path": "/data/saxsdb/sasbdb/entries/q9/sasddq9/source/SASDDQ9.dat",
"size": 31037,
"sha256": "685496af83e830e4c408d99f29493ba9aec791c3fa9578763c8192fe97ab050e",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDQ9.out",
"path": "/data/saxsdb/sasbdb/entries/q9/sasddq9/source/SASDDQ9.out",
"size": 43597,
"sha256": "c62557f2d18db6024b878dc481c199aef3d4ab76a9259f55c33aa84ec421ebd5",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDQ9.sascif",
"path": "/data/saxsdb/sasbdb/entries/q9/sasddq9/source/SASDDQ9.sascif",
"size": 282706,
"sha256": "6b1549ecfc4cf1eaff37964860d050fe38f1c2d951fbc09a117571289b27f8f0",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDQ9.zip",
"path": "/data/saxsdb/sasbdb/entries/q9/sasddq9/source/SASDDQ9.zip",
"size": 49404,
"sha256": "1c9a651affce5e4e47e75a40799e9460b4aba98b67a1e71d20b366e6687130c8",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
