The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDS4",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "An N-terminally truncated form of cyclic GMP-dependent protein kinase Iα (PKG Iα) is monomeric and autoinhibited and provides a model for activation.",
"publication": {
"title": "An N-terminally truncated form of cyclic GMP-dependent protein kinase Iα (PKG Iα) is monomeric and autoinhibited and provides a model for activation.",
"author_list": "Moon TM, Sheehe JL, Nukareddy P, Nausch LW, Wohlfahrt J, Matthews DE, Blumenthal DK, Dostmann WR",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.RA117.000647",
"pmid": "29602907",
"published_date": "2018 May 25"
},
"status": "released",
"submitted_date": "2018-03-02",
"released_date": "2018-03-28"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDS4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDS4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDS4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDS4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Rayonix MX225-HE",
"resolution": null
},
"name": "Stanford Synchrotron Radiation Lightsource (SSRL)",
"city": "Menlo Park, CA",
"country": "USA",
"beamline_name": "BL4-2",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "cGMP-dependent protein kinase 1",
"short_name": "∆53 PKG Iα",
"sequence": "GAMDIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF",
"organism": "Bos taurus",
"uniprot_code": "P00516",
"uniprot_range_first": 54,
"uniprot_range_last": 671,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR\nAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY\nPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT\nVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET\nHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDV\nRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF\nNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF\nIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI\nIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD\nYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS\nERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP\nPDDNSGWDIDF",
"mw": 70.433,
"total_mw": 70.433,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM MES, 300 mM NaCl, 1 mM TCEP, 5 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.9,
"deuteration": null
},
"purity_method": null,
"name": "cGMP-dependent protein kinase 1: ∆53 PKG Iα",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Tucson, AZ, USA",
"full_name": "University of Arizona",
"webpage": "http://www.arizona.edu/"
}
],
"contributor_name": "Thomas",
"contributor_surname": "Moon",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-06-06",
"storage_temperature": 4.0,
"cell_temperature": 22.0,
"exposure_time": 1.0,
"number_of_frames": 600,
"wavelength": 0.1127,
"sample_detector_distance": 1.7,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.087,
"s_max": 5.136,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDS4_fit1_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDS4_fit1_model1.pdb",
"model_mw": 73.548,
"bead_radius": 3.25,
"log": null,
"symmetry": "p1",
"comment": "Filtered, Averaged 3-D envelope",
"user": 268
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDS4_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 0.602,
"p_value": 0.999,
"fit_residual_plot": "SASDDS4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDS4_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/DAMMINon_102.log",
"software_version": "online",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of cGMP-dependent protein kinase 1 (∆53 PKG Iα) were collected using SEC-SAXS on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL; Stanford, CA, USA) using a Rayonix MX225-HE detector at a sample-detector distance of 1.7 m and at a wavelength of λ = 0.1127 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). A 35 μL sample of 6 mg/mL PKG Iα ∆53 was injected onto a Superdex 200 3.2/30 column (GE) and eluted isocratically using an Ettan FPLC (GE) at 0.05 mL/min in 50 mM MES, 300 mM NaCl, 1mM TCEP, pH 6.9 supplemented with 5 mM DTT as a radical scavenger. The eluant stream was connected in-line to a 1.5 mm quartz capillary. Data were collected with a 1 second/frame exposure rate at 22°C. A total of 600 frames were collected. Frames 410-459 containing the peak corresponding to ∆53 PKG were averaged and subtracted from background. The scattering curve, Guinier and P(r) functions, and Porod volume were calculated using the PRIMUS (ATSAS) program suite.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 70.433,
"experimental_mw_error": null,
"guinier_i0_mw": 75.814,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 323.9,
"pddf_i0_error": 1.8,
"guinier_i0": 321.37,
"guinier_i0_error": 2.21,
"pddf_rg": 3.02,
"pddf_rg_error": 0.03,
"guinier_rg": 2.971,
"guinier_rg_error": 0.031,
"pddf_dmax": 9.68,
"pddf_dmax_error": null,
"porod_volume": 105.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 10,
"guinier_point_last": 39,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDS4_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDS4",
"status": "success",
"started_at": "2026-08-11T14:29:58.037312+00:00",
"finished_at": "2026-08-11T14:30:05.940630+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDS4/",
"path": "/data/saxsdb/sasbdb/entries/s4/sasdds4/source/summary.json",
"size": 8860,
"sha256": "6a62c85688b7e3878cdf185fbe1b6046ce310ba798db135ae637e170f0d43d2f"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDS4.dat",
"path": "/data/saxsdb/sasbdb/entries/s4/sasdds4/source/SASDDS4.dat",
"size": 25546,
"sha256": "56fad386f6874eee8d35d3dfe3134c0357c16fe2c93fdbe7a448629610c5c141",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDDS4.out",
"path": "/data/saxsdb/sasbdb/entries/s4/sasdds4/source/SASDDS4.out",
"size": 23278,
"sha256": "07ac3fa13212a993c6a441251a31bd6d2e7bfcf790331e375f5e9037f787dc1a",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDS4.sascif",
"path": "/data/saxsdb/sasbdb/entries/s4/sasdds4/source/SASDDS4.sascif",
"size": 137864,
"sha256": "d341191c7941ec4938192ebd850b0820a500f26c7adc12b7d2425297fb2423e7",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDS4.zip",
"path": "/data/saxsdb/sasbdb/entries/s4/sasdds4/source/SASDDS4.zip",
"size": 27240,
"sha256": "b6fef7717480d25af0e2c3387a8f50e90233fb3069d76aff41762fd84559deb5",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
