Neural/ectodermal development factor IMP-L2

{
  "code": "SASDDS8",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.",
    "publication": {
      "title": "Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.",
      "author_list": "Roed NK, Viola CM, Kristensen O, Schluckebier G, Norrman M, Sajid W, Wade JD, Andersen AS, Kristensen C, Ganderton TR, Turkenburg JP, De Meyts P, Brzozowski AM",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-018-06192-3",
      "pmid": "30242155",
      "published_date": "2018 Sep 21"
    },
    "status": "released",
    "submitted_date": "2018-06-21",
    "released_date": "2018-12-03"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDS8.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS8_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS8_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDS8_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDS8.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "ID14-3",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Neural/ectodermal development factor IMP-L2",
          "short_name": "Imp-L2 IBP",
          "sequence": "MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKF\r\nTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVR\r\nVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTE\r\nKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMG\r\nNYKCIARNVVGKDTADTFVYPVLNEED",
          "organism": "Drosophila melanogaster",
          "uniprot_code": "Q09024",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKF\nTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVR\nVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTE\nKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMG\nNYKCIARNVVGKDTADTFVYPVLNEED",
          "mw": 29.895,
          "total_mw": 59.79,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "phosphate buffered saline",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Neural/ectodermal development factor IMP-L2",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Denmark",
            "full_name": "Novo Nordisk A/S",
            "webpage": "https://www.novonordisk.com/"
          }
        ],
        "contributor_name": "Mathias",
        "contributor_surname": "Norrman",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2011-11-20",
    "storage_temperature": 5.0,
    "cell_temperature": 25.0,
    "exposure_time": 10.0,
    "number_of_frames": 10,
    "wavelength": 0.093,
    "sample_detector_distance": 2.43,
    "concentration_min": 3.2,
    "concentration_max": 12.8,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.074,
    "s_max": 5.515,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of neural/ectodermal development factor IMP-L2 in phosphate buffered saline, pH 7.4 were collected on the ID14-3 beam line at the ESRF (Grenoble, France) using a  Pilatus 1M detector at a sample-detector distance of 2.4 m and at a wavelength of λ = 0.093 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 3.2 and 12.8 mg/ml were measured at 25°C. 10 successive 10 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 63.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 40.91,
  "guinier_i0_error": 0.038,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 3.07,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 12.0,
  "pddf_dmax_error": null,
  "porod_volume": 93.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 31,
  "guinier_point_last": 61,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDS8_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDS8",
  "status": "success",
  "started_at": "2026-08-11T15:59:35.868371+00:00",
  "finished_at": "2026-08-11T15:59:41.954743+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDS8/",
      "path": "/data/saxsdb/sasbdb/entries/s8/sasdds8/source/summary.json",
      "size": 6531,
      "sha256": "121aadd69fee90b792b6bcdd0b80d3c20220f230a9a65efaf250118274b1a51b"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDS8.dat",
      "path": "/data/saxsdb/sasbdb/entries/s8/sasdds8/source/SASDDS8.dat",
      "size": 52745,
      "sha256": "bf75b6cb83105aa7f4c5f1216298a729d2ac2fe55c23f7686c3a6dd75ffe64ec",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/s8/sasdds8/source/SASDDS8.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDS8.sascif",
      "path": "/data/saxsdb/sasbdb/entries/s8/sasdds8/source/SASDDS8.sascif",
      "size": 67616,
      "sha256": "a41cfff0c480e8b46ffe7b038fdfd645bcc21af4924144fa79256a73c4def658",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDS8.zip",
      "path": "/data/saxsdb/sasbdb/entries/s8/sasdds8/source/SASDDS8.zip",
      "size": 14083,
      "sha256": "84f7fc4b1e2a4edd227229de7c48378024553456b908b1e59e5ed387e9ea2aa2",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}