Nonstructural protein sigma NS - apoprotein

{
  "code": "SASDDU5",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Stability of local secondary structure determines selectivity of viral RNA chaperones.",
    "publication": {
      "title": "Stability of local secondary structure determines selectivity of viral RNA chaperones.",
      "author_list": "Bravo JPK, Borodavka A, Barth A, Calabrese AN, Mojzes P, Cockburn JJB, Lamb DC, Tuma R",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gky394",
      "pmid": "29796667",
      "published_date": "2018 May 18"
    },
    "status": "released",
    "submitted_date": "2018-04-01",
    "released_date": "2018-04-26"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDU5.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDU5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU5_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDU5_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDU5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nonstructural protein sigma NS",
          "short_name": null,
          "sequence": "MDNTVRVGVSRNTSGAAGQTLFRNFYLLRCNISADGRNATKAVQSHFPFLSRAVRCLSPL\r\nAAHCADRTLRRDNVKQILTRELPFSSDLINYAHHVNSSSLTTSQGVEAARLVAQVYGEQV\r\nPFDHIYPTGSATYCPGAIANAISRIMAGFVPREGDDFAPSGPIDYLAADLIAYKFVLPYM\r\nLDMVDGRPQIVLPSHTVEEMLTNTSLLNSIDASFGIEARSDQRMTRDAAEMSSRSLNELE\r\nDHDQRGRMPWKIMLAMMAAQLKVELDALADERTESQANAHVTSFGSRLFNQMSAFVTIDR\r\nELMELALLIKEQGFAMNPGQIASKWSLIRRSGPTRPLSGARLEIRNGNWMIREGDQTLLS\r\nVSPARMA",
          "organism": "Avian orthoreovirus",
          "uniprot_code": "Q9DH28",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "hexamer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDNTVRVGVSRNTSGAAGQTLFRNFYLLRCNISADGRNATKAVQSHFPFLSRAVRCLSPL\nAAHCADRTLRRDNVKQILTRELPFSSDLINYAHHVNSSSLTTSQGVEAARLVAQVYGEQV\nPFDHIYPTGSATYCPGAIANAISRIMAGFVPREGDDFAPSGPIDYLAADLIAYKFVLPYM\nLDMVDGRPQIVLPSHTVEEMLTNTSLLNSIDASFGIEARSDQRMTRDAAEMSSRSLNELE\nDHDQRGRMPWKIMLAMMAAQLKVELDALADERTESQANAHVTSFGSRLFNQMSAFVTIDR\nELMELALLIKEQGFAMNPGQIASKWSLIRRSGPTRPLSGARLEIRNGNWMIREGDQTLLS\nVSPARMA",
          "mw": 40.586,
          "total_mw": 243.516,
          "number_molecules": 6,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM HEPES, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Nonstructural protein sigma NS - apoprotein",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Leeds, UK",
            "full_name": "University of Leeds",
            "webpage": "https://www.leeds.ac.uk/"
          }
        ],
        "contributor_name": "Jack",
        "contributor_surname": "Bravo",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-02-25",
    "storage_temperature": null,
    "cell_temperature": null,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": 0.1,
    "sample_detector_distance": 3.9,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.037,
    "s_max": 3.7,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Sample concentration, UNKNOWN; Sample temperature, UNKNOWN; Exposure time; UNKNOWN.",
  "experiment_description": "Synchrotron SAXS data from solutions of nonstructural protein sigma NS (apoprotein) in 25 mM HEPES, 150 mM NaCl, pH 7.5 were collected on the B21 beam line at the Diamond Light Source storage ring (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 3.9 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 240.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": 240.0,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.3215,
  "pddf_i0_error": null,
  "guinier_i0": 0.3194,
  "guinier_i0_error": 0.001,
  "pddf_rg": 5.66,
  "pddf_rg_error": null,
  "guinier_rg": 5.492,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 23.1,
  "pddf_dmax_error": null,
  "porod_volume": 670.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 17,
  "guinier_point_last": 84,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDU5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDU5",
  "status": "success",
  "started_at": "2026-08-11T14:56:24.175456+00:00",
  "finished_at": "2026-08-11T14:56:32.807923+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDU5/",
      "path": "/data/saxsdb/sasbdb/entries/u5/sasddu5/source/summary.json",
      "size": 6553,
      "sha256": "809ed37062fa2aa2013999c403664589388da02a7df74b10756d19bedc2a2478"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDU5.dat",
      "path": "/data/saxsdb/sasbdb/entries/u5/sasddu5/source/SASDDU5.dat",
      "size": 75321,
      "sha256": "74b264e81bc407a9c3ce2e63fdb63d6c5c620d03cd337d0db2f799d57ff1ad70",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDU5.out",
      "path": "/data/saxsdb/sasbdb/entries/u5/sasddu5/source/SASDDU5.out",
      "size": 96077,
      "sha256": "07fbbc5992fccff8041d9b9097537d8acb161a3a6e1d721830b4b3d7a209a3db",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDU5.sascif",
      "path": "/data/saxsdb/sasbdb/entries/u5/sasddu5/source/SASDDU5.sascif",
      "size": 153150,
      "sha256": "69b0caccc2df2df41a329eba303c4e75ea711ac80c98c03c6047f033c573f27d",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDU5.zip",
      "path": "/data/saxsdb/sasbdb/entries/u5/sasddu5/source/SASDDU5.zip",
      "size": 46222,
      "sha256": "07f07bb04a8b555524d31ea149f0f0650a44485fc410d55dcd4bb2f0a30731c1",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}