The ferredoxin protease, FusC, E83A mutant

{
  "code": "SASDDU6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "FusC, a member of the M16 protease family acquired by bacteria for iron piracy against plants.",
    "publication": {
      "title": "FusC, a member of the M16 protease family acquired by bacteria for iron piracy against plants.",
      "author_list": "Grinter R, Hay ID, Song J, Wang J, Teng D, Dhanesakaran V, Wilksch JJ, Davies MR, Littler D, Beckham SA, Henderson IR, Strugnell RA, Dougan G, Lithgow T",
      "journal": "PLoS Biol",
      "doi": "10.1371/journal.pbio.2006026",
      "pmid": "30071011",
      "published_date": "2018 Aug"
    },
    "status": "released",
    "submitted_date": "2018-05-19",
    "released_date": "2018-06-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDU6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDU6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDU6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDU6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDU6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "Australian  Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": "Point",
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Ferredoxin protease E83A mutant",
          "short_name": "FusC E83A",
          "sequence": "EEIKSPLPVFKEGTLANGFRYTLVQLEGPKTRVDIRLIVDVGSIDEKDNESGVAH\r\nMVAHMVFRASDAFPQGVSTELHKQGWGRGQSYNAVTNYERTMYMMSPPKGNLDLGATLQALSQMTGHAKLLQSDLDDERK\r\nIILEEWRGKLGVAERMNQQRVQAIRHDSRYPSRPVIGTEESINDTPASVLQDFYQRWYHPSNMRLMIIGDITPADAEREI\r\nQRYFAALPNVAVPTRDYYEPLLKPQLKVARLQDSQSGSSQVSFVYRFNDKDAFGQSEYRHRLLTQITMSAVTRQVRRQKA\r\nELPQDASSLVVRKSDIGKTTAALGFFANVMPGGHDAAISAVLKEIERFKRYPLNEQDITEITSDIREVAQRMSVTPETRE\r\nFADWVQQLTIVWQQDRPYVGSQQRGKDALEALDTIKGEDVNRHWQRWLASPDTLAQFSVPGATPFTLPKPDAISKLQKQW\r\nALATLAPLRLEEKKIIPELPSVTQSGKRTAVKTFAAQKVEQWQLSNGDRVVWLRAPEAGKKVYLTATSQAGFMATAMNPW\r\nQAQLASQLVNQSGPATWSGESLSNWKKEKTLSLSIDQEADQLTLSGTAPTEQLASLFGLYRELNVAPGIDPDVMKESMMS\r\nLARQKANDDQSVGGKRASEMTKLRFGEPAWQQPEIAELKKISAPALLSQWHKAASAPVTYYLIADMPATQLLPQVERYLA\r\nTIPRQPASEVKQHLALSGKREATSAINVEPRADILTWSFTPHAWTPQAAVQVSIARNIASKYLKTSLRDDALGIYRMRVD\r\nSELEDKKQRIETEVSFTSAPERAQELWTLAEQAFSELPTKITQQDVDEQKAQFIRAEKGRQGDLTTIQRRLILSYRHYND\r\nPRYLSNASKLADSITLESVRAMSAKLYNPDNRVLYITLPQEVKE",
          "organism": "Pectobacterium atrosepticum SCRI1043",
          "uniprot_code": "Q6D8U3",
          "uniprot_range_first": 26,
          "uniprot_range_last": 924,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MNWKKCCWLSLTAVGLLAGSVVSQAEEIKSPLPVFKEGTLANGFRYTLVQLEGPKTRVDI\nRLIVDVGSIDEKDNESGVAHMVEHMVFRASDAFPQGVSTELHKQGWGRGQSYNAVTNYER\nTMYMMSPPKGNLDLGATLQALSQMTGHAKLLQSDLDDERKIILEEWRGKLGVAERMNQQR\nVQAIRHDSRYPSRPVIGTEESINDTPASVLQDFYQRWYHPSNMRLMIIGDITPADAEREI\nQRYFAALPNVAVPTRDYYEPLLKPQLKVARLQDSQSGSSQVSFVYRFNDKDAFGQSEYRH\nRLLTQITMSAVTRQVRRQKAELPQDASSLVVRKSDIGKTTAALGFFANVMPGGHDAAISA\nVLKEIERFKRYPLNEQDITEITSDIREVAQRMSVTPETREFADWVQQLTIVWQQDRPYVG\nSQQRGKDALEALDTIKGEDVNRHWQRWLASPDTLAQFSVPGATPFTLPKPDAISKLQKQW\nALATLAPLRLEEKKIIPELPSVTQSGKRTAVKTFAAQKVEQWQLSNGDRVVWLRAPEAGK\nKVYLTATSQAGFMATAMNPWQAQLASQLVNQSGPATWSGESLSNWKKEKTLSLSIDQEAD\nQLTLSGTAPTEQLASLFGLYRELNVAPGIDPDVMKESMMSLARQKANDDQSVGGKRASEM\nTKLRFGEPAWQQPEIAELKKISAPALLSQWHKAASAPVTYYLIADMPATQLLPQVERYLA\nTIPRQPASEVKQHLALSGKREATSAINVEPRADILTWSFTPHAWTPQAAVQVSIARNIAS\nKYLKTSLRDDALGIYRMRVDSELEDKKQRIETEVSFTSAPERAQELWTLAEQAFSELPTK\nITQQDVDEQKAQFIRAEKGRQGDLTTIQRRLILSYRHYNDPRYLSNASKLADSITLESVR\nAMSAKLYNPDNRVLYITLPQEVKE",
          "mw": 101.195,
          "total_mw": 101.195,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "The ferredoxin protease, FusC, E83A mutant",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Melbourne, Australia",
            "full_name": "Monash University",
            "webpage": "http://www.monash.edu/"
          }
        ],
        "contributor_name": "Grinter",
        "contributor_surname": "Grinter",
        "orcid": "https://orcid.org/0000-0002-8195-5348"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-10-26",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": 1.03,
    "sample_detector_distance": 1.28,
    "concentration_min": null,
    "concentration_max": 3.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.114,
    "s_max": 3.038,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "FusC E83A mutant at 30 uM (in the absence of Arabidopsis ferredoxin).",
  "experiment_description": "Synchrotron SAXS data from solutions of ferredoxin protease, FusC, E83A mutant in 20 mM Tris, 150 mM NaCl, pH 7.8 were collected on the SAXS/WAXS beam line at the Australian Synchrotron storage ring (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 1.3 m and at a wavelength of λ = 1.03 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 100.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 89.6,
  "porod_mw_error": null,
  "pddf_i0": 0.2796,
  "pddf_i0_error": null,
  "guinier_i0": 0.28,
  "guinier_i0_error": 0.00015,
  "pddf_rg": 3.7,
  "pddf_rg_error": null,
  "guinier_rg": 3.65,
  "guinier_rg_error": 0.005,
  "pddf_dmax": 13.75,
  "pddf_dmax_error": null,
  "porod_volume": 152.3,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 34,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDU6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDU6",
  "status": "success",
  "started_at": "2026-08-11T15:15:52.293119+00:00",
  "finished_at": "2026-08-11T15:16:00.057935+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDU6/",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasddu6/source/summary.json",
      "size": 7908,
      "sha256": "b53d3f933fbe7490c70d1903de64b8b3a7b27e2d85c18cb311c284e4e81a7260"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDU6.dat",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasddu6/source/SASDDU6.dat",
      "size": 18518,
      "sha256": "ef83379425f42f5db7ba3a04dd9ab3488508e138c66cf3eb75250aa7c0fb0873",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDU6.out",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasddu6/source/SASDDU6.out",
      "size": 30635,
      "sha256": "3f4083e95202d2fdf2d8ee2271dfb71c9172e089b70ba2042f30e5be8f6a96aa",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDU6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasddu6/source/SASDDU6.sascif",
      "size": 47250,
      "sha256": "d9abfa1ba05a3a1baed86cae0c0d9ebb24086130535120985c2825543f925eca",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDU6.zip",
      "path": "/data/saxsdb/sasbdb/entries/u6/sasddu6/source/SASDDU6.zip",
      "size": 14114,
      "sha256": "ddff8bf29f719d777bd7c6095bb9b2738b9125513ac7a9ff3ea221982ac6e596",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}