The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDX2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Structural variability of EspG chaperones from mycobacterial ESX-1, ESX-3 and ESX-5 type VII secretion systems",
"publication": {
"title": "Structural variability of EspG chaperones from mycobacterial ESX-1, ESX-3 and ESX-5 type VII secretion systems",
"author_list": "Tuukkanen A, Freire D, Chan S, Arbing M, Reed R, Evans T, Zenkeviciutė G, Kim J, Kahng S, Sawaya M, Chaton C, Wilmanns M, Eisenberg D, Parret A, Korotkov K",
"journal": null,
"doi": "10.1101/250803",
"pmid": null,
"published_date": "2018 Jan 24"
},
"status": "released",
"submitted_date": "2018-01-09",
"released_date": "2018-01-24"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDX2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDX2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDX2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDX2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "EspG3 chaperone from Mycobacterium tuberculosis",
"short_name": "EspG3Mtb",
"sequence": "MHHHHHHENLYFQGSHMDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": "P9WJC6",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLL\nSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGN\nGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSG\nVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRV\nLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS",
"mw": 33.6,
"total_mw": 33.6,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "PE5 from Mycobacterium tuberculosis",
"short_name": "PE5",
"sequence": "MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVE\r\nHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": "L7N695",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVE\nHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG",
"mw": 9.6,
"total_mw": 9.6,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "PPE4 from Mycobacterium tuberculosis",
"short_name": "PPE4",
"sequence": "MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAW\r\nQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIH\r\nTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNP\r\nGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTN\r\nPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPA\r\nVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASF\r\nAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDE\r\nFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRM\r\nPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": "P9WI43",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAW\nQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIH\nTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNP\nGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTN\nPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPA\nVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASF\nAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDE\nFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRM\nPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK",
"mw": 51.8,
"total_mw": 51.8,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES pH 7.5, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "EspG3-PE5/PPE4 complex from M. tuberculosis",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Anne",
"contributor_surname": "Tuukkanen",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-06-15",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 1.22,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.083,
"s_max": 4.011,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDX2_fit1_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.6147,
"p_value": 0.009372,
"fit_residual_plot": "SASDDX2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDX2_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 83.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.003034,
"pddf_i0_error": null,
"guinier_i0": 0.00299,
"guinier_i0_error": 0.00015,
"pddf_rg": 4.197,
"pddf_rg_error": null,
"guinier_rg": 3.98,
"guinier_rg_error": 0.03,
"pddf_dmax": 14.2,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 9,
"guinier_point_last": 90,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDX2_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
