Protein translocase subunit SecA (full length, amino acids 1-901)

{
  "code": "SASDDY9",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/nm",
  "project": {
    "title": "The C-terminal tail of the bacterial translocation ATPase SecA modulates its activity.",
    "publication": {
      "title": "The C-terminal tail of the bacterial translocation ATPase SecA modulates its activity.",
      "author_list": "Jamshad M, Knowles TJ, White SA, Ward DG, Mohammed F, Rahman KF, Wynne M, Hughes GW, Kramer G, Bukau B, Huber D",
      "journal": "Elife",
      "doi": "10.7554/eLife.48385",
      "pmid": "31246174",
      "published_date": "2019 Jun 27"
    },
    "status": "released",
    "submitted_date": "2018-07-24",
    "released_date": "2019-08-29"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDY9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDY9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDY9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDY9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDY9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDY9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDY9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Protein translocase subunit SecA",
          "short_name": null,
          "sequence": "MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVL\r\nENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA\r\nLTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNN\r\nEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVN\r\nKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYS\r\nPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK\r\nEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR\r\nKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLN\r\nAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKAD\r\nWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFAS\r\nDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY\r\nSQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPI\r\nAEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA\r\nAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEEL\r\nEQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRL\r\nQ",
          "organism": "Escherichia coli",
          "uniprot_code": "P10408",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVL\nENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA\nLTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNN\nEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVN\nKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYS\nPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK\nEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR\nKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLN\nAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKAD\nWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFAS\nDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY\nSQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPI\nAEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA\nAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEEL\nEQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRL\nQ",
          "mw": 102.022,
          "total_mw": 204.044,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20mM HEPES, 100mM NaCl, 1mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Protein translocase subunit SecA (full length, amino acids 1-901)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Birmingham, UK",
            "full_name": "University of Birmingham",
            "webpage": "https://www.birmingham.ac.uk"
          }
        ],
        "contributor_name": "Timothy",
        "contributor_surname": "Knowles",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-07-18",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 45,
    "wavelength": 0.0919,
    "sample_detector_distance": 2.867,
    "concentration_min": null,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.028,
    "s_max": 4.952,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Additional SEC parameters: Column type, S200 10/300 GL (GE Lifesciences); Flow rate, 1.0mL/min; Sample injection concentration, 5mg/mL; Injection volume, 0.5mL",
  "experiment_description": "Synchrotron SAXS data, I(s) vs s (s = 4π sin θ/λ, where 2θ is the scattering angle) were collected from a sample of full length SecA using continuous-flow size-exclusion chromatography SAXS (SEC-SAXS) on the BM29 beam line at the ESRF (Grenoble, France). Data were collected using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.0919 nm. The SEC mobile phase consisted of 20mM HEPES, 100mM NaCl, 1mM TCEP, pH 8 (20°C). Data obtained from solute-free eluates and SEC-elution peak (45 successive 1 s data frames) were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted from the SEC-peak frames to produce the data displayed in this entry.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 232.267,
  "experimental_mw_error": null,
  "guinier_i0_mw": 224.7,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 144.0,
  "pddf_i0_error": null,
  "guinier_i0": 144.47,
  "guinier_i0_error": 0.076,
  "pddf_rg": 4.186,
  "pddf_rg_error": null,
  "guinier_rg": 4.22,
  "guinier_rg_error": 0.0,
  "pddf_dmax": 14.89,
  "pddf_dmax_error": null,
  "porod_volume": 424.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 23,
  "guinier_point_last": 60,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDY9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDY9",
  "status": "success",
  "started_at": "2026-08-11T16:29:15.444262+00:00",
  "finished_at": "2026-08-11T16:29:24.034302+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDY9/",
      "path": "/data/saxsdb/sasbdb/entries/y9/sasddy9/source/summary.json",
      "size": 8023,
      "sha256": "225927cb5397f01b83a5f9f55b35e4c09e7d33fe747f8dd61493c459cb0ba4a0"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDY9.dat",
      "path": "/data/saxsdb/sasbdb/entries/y9/sasddy9/source/SASDDY9.dat",
      "size": 78236,
      "sha256": "cc73500389893964dfefc89b4d0cba4f074d9160541a6358bc13dc89c72dd24b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDY9.out",
      "path": "/data/saxsdb/sasbdb/entries/y9/sasddy9/source/SASDDY9.out",
      "size": 37971,
      "sha256": "9891dfd3a3a416acd4235e874ba3e2c4339e70de4207b4877d4cb6578f29db4d",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDY9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/y9/sasddy9/source/SASDDY9.sascif",
      "size": 88335,
      "sha256": "05e28e3fb0450135122b106114693a807cdd559846d4dde182b38f2d92068939",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDY9.zip",
      "path": "/data/saxsdb/sasbdb/entries/y9/sasddy9/source/SASDDY9.zip",
      "size": 41094,
      "sha256": "37d138bb3d97dca601b2119b431541b3d388bc36e7a789090d881ebd6ffabe07",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}