The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDE29",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Functional Relevance of Interleukin-1 Receptor Inter-domain Flexibility for Cytokine Binding and Signaling.",
"publication": {
"title": "Functional Relevance of Interleukin-1 Receptor Inter-domain Flexibility for Cytokine Binding and Signaling.",
"author_list": "Ge J, Remesh SG, Hammel M, Pan S, Mahan AD, Wang S, Wang X",
"journal": "Structure",
"doi": "10.1016/j.str.2019.05.011",
"pmid": "31257107",
"published_date": "2019 Aug 6"
},
"status": "released",
"submitted_date": "2018-12-11",
"released_date": "2019-09-13"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE29.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE29.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE29_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE29_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE29_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE29_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE29.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Interleukin-1 receptor accessory protein ectodomain with RI linker",
"short_name": null,
"sequence": "SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVLEENKPTRPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKAAALHHILDAQKMVWNHRHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "Q9NPH3",
"uniprot_range_first": 21,
"uniprot_range_last": 348,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST\nAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT\nYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG\nCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA\nVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE\nSISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL\nACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF\nVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL\nLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK\nQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV",
"mw": 40.876,
"total_mw": 40.876,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10mM HEPES, 150mM NaCl, 3% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.2,
"deuteration": null
},
"purity_method": null,
"name": "Interleukin-1 receptor accessory protein ectodomain with RI linker",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Taiwan",
"full_name": "National Cheng Kung University",
"webpage": "http://www.ncku.edu.tw/"
}
],
"contributor_name": "Shu-Ying",
"contributor_surname": "Wang",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-08-11",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.103,
"sample_detector_distance": 1.5,
"concentration_min": null,
"concentration_max": 10.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.142,
"s_max": 5.38,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE29_fit1_model1_img.png",
"software": "BILBOMD",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDE29_fit1_model1.pdb",
"model_mw": 118.7,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 393
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE29_fit1_model2_img.png",
"software": "BILBOMD",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDE29_fit1_model2.pdb",
"model_mw": 118.7,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 393
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/multi_state_model_2_1_1_HTlPEKC_fitfoxs_img.png",
"software": "MES-FoXS",
"chi_square_value": 2.347585,
"p_value": 0.0,
"fit_residual_plot": "multi_state_model_2_1_1_HTlPEKC_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDE29_fit1.dat",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.5a",
"i0_calibration_standard": null,
"description": "SEC-SAXS was performed at 20°C using the following parameters: Column: Schodex kw-803 ; Flow rate: 0.5 mL/min; Total acquisition time: 30min; Sample injection concentration: 10 mg/mL; Injection volume: 50 μL.",
"experiment_description": "SSynchrotron SAXS data from solutions of Interleukin-1 receptor accessory protein ectodomain with RI linker in 10mM HEPES, 150mM NaCl, 3% glycerol, pH 7.2 were measured using size-exclusion chromatography SAXS (SEC-SAXS) on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a Pilatus3 X 2M detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.103 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The data were collected as 600 successive 3 second frames through the SEC elution profile. Sample-elution peak data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 49.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 82.55,
"pddf_i0_error": null,
"guinier_i0": 82.2,
"guinier_i0_error": 0.86,
"pddf_rg": 3.04,
"pddf_rg_error": null,
"guinier_rg": 3.037,
"guinier_rg_error": 0.04,
"pddf_dmax": 10.39,
"pddf_dmax_error": null,
"porod_volume": 76.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 48,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDE29_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-11-27T12:02:24.063588+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDE29",
"status": "success",
"started_at": "2026-08-11T16:44:14.079839+00:00",
"finished_at": "2026-08-11T16:44:23.629217+00:00",
"source_last_modified": "2020-11-27T12:02:24.063588+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE29/",
"path": "/data/saxsdb/sasbdb/entries/29/sasde29/source/summary.json",
"size": 8857,
"sha256": "6481e3b9a0c1181133a43a154950c54ddb98c7827a51efdb018d66dd38b06224"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDE29.dat",
"path": "/data/saxsdb/sasbdb/entries/29/sasde29/source/SASDE29.dat",
"size": 36595,
"sha256": "276e0483379834ffea97eb163b49414d6ef68fd5d6ca43770f038b0140d51dd4",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDE29.out",
"path": "/data/saxsdb/sasbdb/entries/29/sasde29/source/SASDE29.out",
"size": 37769,
"sha256": "852f2bbb56cf982148f9f8a1420be3393375f60da44c91a9bfbe55090570dd65",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE29.sascif",
"path": "/data/saxsdb/sasbdb/entries/29/sasde29/source/SASDE29.sascif",
"size": 1424933,
"sha256": "92c954a925b2d332e498b3bc725d95cc8839be6fbce8c9fe407e946540dedcf7",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDE29.zip",
"path": "/data/saxsdb/sasbdb/entries/29/sasde29/source/SASDE29.zip",
"size": 247207,
"sha256": "e9d0e694bb4aa2e6df051e3c17d3a5dc95bcb6f7c8f57453731079c552663cdb",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
